StarFunc result for job id Q96JK9

User Input

>input (1138 residues)
MGDFAAPAAAANGSSICINSSLNSSLGGAGIGVNNTPNSTPAAPSSNHPAAGGCGGSGGP
GGGSAAVPKHSTVVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQRTLEQ
RAKKSGAGTGKQQHPSKPQQDAEAASAEQRNHTLIMLQETVKRKLEGARSPLNGDQQNGA
CDGNFSPTSKRIRKDISAGMEAINNLPSNMPLPSASPLHQLDLKPSLPLQNSGTHTPGLL
EDLSKNGRLPEIKLPVNGCSDLEDSFTILQSKDLKQEPLDDPTCIDTSETSLSNQNKLFS
DINLNDQEWQELIDELANTVPEDDIQDLFNEDFEEKKEPEFSQPATETPLSQESASVKSD
PSHSPFAHVSMGSPQARPSSSGPPFSTVSTATSLPSVASTPAAPNPASSPANCAVQSPQT
PNQAHTPGQAPPRPGNGYLLNPAAVTVAGSASGPVAVPSSDMSPAEQLKQMAAQQQQRAK
LMQQKQQQQQQQQQQQQQQQQQQQQQQQQQHSNQTSNWSPLGPPSSPYGAAFTAEKPNSP
MMYPQAFNNQNPIVPPMANNLQKTTMNNYLPQNHMNMINQQPNNLGTNSLNKQHNILTYG
NTKPLTHFNADLSQRMTPPVANPNKNPLMPYIQQQQQQQQQQQQQQQQQQPPPPQLQAPR
AHLSEDQKRLLLMKQKGVMNQPMAYAALPSHGQEQHPVGLPRTTGPMQSSVPPGSGGMVS
GASPAGPGFLGSQPQAAIMKQMLIDQRAQLIEQQKQQFLREQRQQQQQQQQQILAEQQLQ
QSHLPRQHLQPQRNPYPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGP
SQNPGTMATAAAQSEMGLAPYSTTPTSQPGMYNMSTGMTQMLQHPNQSGMSITHNQAQGP
RQPASGQGVGMVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGA
QSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPRLTKQHFPQGLSQSVVDANTGTVRT
LNPAAMGRQMMPSLPGQQGTSQARPMVMSGLSQGVPGMPAFSQPPAQQQIPSGSFAPSSQ
SQAYERNAPQDVSYNYSGDGAGGSFPGLPDGADLVDSIIKGGPGDEWMQELDELFGNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JK9	0.999	0.999	0.000	1138	1.000	1.000	Q96JK9.pdb.gz	MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens OX=9606 GN=MAML3 PE=1 SV=4
2	AFDB:Q86B80	0.053	0.039	6.442E-5	1744	0.163	0.106	Q86B80.pdb.gz	Q86B80_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7029 PE=4 SV=1
3	AFDB:Q9UMZ2	0.045	0.041	4.437E-4	1314	0.145	0.126	Q9UMZ2.pdb.gz	SYNRG_HUMAN Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2
4	AFDB:Q554C5	0.052	0.047	1.296E-3	1271	0.120	0.107	Q554C5.pdb.gz	WRKY1_DICDI Probable WRKY transcription factor protein 1 OS=Dictyostelium discoideum OX=44689 GN=wrky1 PE=3 SV=2
5	AFDB:Q54MI3	0.050	0.046	1.392E-3	1278	0.159	0.142	Q54MI3.pdb.gz	SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum OX=44689 GN=sun2 PE=3 SV=1
6	AFDB:Q24079	0.058	0.055	1.853E-3	1221	0.144	0.134	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
7	AFDB:Q6DRQ0	0.041	0.047	2.138E-3	925	0.104	0.128	Q6DRQ0.pdb.gz
8	AFDB:Q61602	0.040	0.029	2.466E-3	1583	0.150	0.108	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
9	AFDB:Q9VRY4	0.048	0.032	4.067E-3	1833	0.142	0.088	Q9VRY4.pdb.gz	Q9VRY4_DROME LD13895p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=3
10	AFDB:Q5PR69	0.053	0.050	6.245E-3	1207	0.152	0.143	Q5PR69.pdb.gz	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4
11	PDB:5wlcNB	0.037	0.250	2.508	142	0.015	0.120	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:7mqaNB	0.033	0.213	5.125	103	0.010	0.107	7mqaNB.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:4n78F	0.028	0.177	7.327	156	0.010	0.071	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:7qooU	0.058	0.270	7.327	186	0.013	0.081	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96JK9	0.0	2276	1138	1.000	1.000	MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens OX=9606 GN=MAML3 PE=1 SV=4
2	Q92585	1.87e-124	409	1016	0.339	0.380	MAML1_HUMAN Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3
3	Q6T264	7.65e-115	383	1020	0.322	0.359	MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus OX=10090 GN=Maml1 PE=1 SV=2
4	Q8IZL2	1.81e-08	61.2	1156	0.024	0.023	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
5	P21519	2.6	34.7	1594	0.025	0.018	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09596 MamL-1	4.1e-16	70.3	MamL-1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.953	Recombining binding protein suppressor of hairless
2	9606.ENSP00000263388	0.952	Neurogenic locus notch homolog protein 3
3	9606.ENSP00000277541	0.952	Neurogenic locus notch homolog protein 1
4	9606.ENSP00000364163	0.952	Neurogenic locus notch homolog protein 4
5	9606.ENSP00000367714	0.922	Transcription factor HES-5
6	9606.ENSP00000338272	0.917	Hairy/enhancer-of-split related with YRPW motif protein 1
7	9606.ENSP00000479618	0.913	Myc proto-oncogene protein
8	9606.ENSP00000361943	0.912	Hairy/enhancer-of-split related with YRPW motif-like protein
9	9606.ENSP00000232424	0.908	Transcription factor HES-1
10	9606.ENSP00000357348	0.906	Hairy/enhancer-of-split related with YRPW motif protein 2
11	9606.ENSP00000477815	0.904	Pre T-cell antigen receptor alpha
12	9606.ENSP00000357429	0.902	Fatty acid-binding protein, brain
13	9606.ENSP00000247191	0.901	Disks large-associated protein 5
14	9606.ENSP00000216341	0.900	Granzyme B
15	9606.ENSP00000261937	0.900	Vascular endothelial growth factor receptor 3
16	9606.ENSP00000264072	0.900	Low affinity immunoglobulin epsilon Fc receptor
17	9606.ENSP00000317128	0.900	Plexin-D1
18	9606.ENSP00000402373	0.900	Actin, aortic smooth muscle
19	9606.ENSP00000405890	0.900	Pre-B-cell leukemia transcription factor 1
20	9606.ENSP00000427772	0.900	Protein KIBRA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0050896	0.991	response to stimulus
GO:0010468	0.991	regulation of gene expression
GO:0010556	0.990	regulation of macromolecule biosynthetic process
GO:0048522	0.988	positive regulation of cellular process
GO:0031326	0.987	regulation of cellular biosynthetic process
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0007166	0.977	cell surface receptor signaling pathway
GO:0007219	0.961	Notch signaling pathway
GO:0010604	0.946	positive regulation of macromolecule metabolic process
GO:0006357	0.941	regulation of transcription by RNA polymerase II
GO:0010557	0.926	positive regulation of macromolecule biosynthetic process
GO:0045935	0.925	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.922	positive regulation of cellular biosynthetic process
GO:0045893	0.913	positive regulation of DNA-templated transcription
GO:0045944	0.897	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.986	nuclear body
GO:0016607	0.975	nuclear speck
GO:0032991	0.919	protein-containing complex
GO:0005737	0.761	cytoplasm
GO:0043228	0.433	non-membrane-bounded organelle
GO:0043232	0.421	intracellular non-membrane-bounded organelle
GO:0005829	0.406	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]