StarFunc result for job id Q96JM2

User Input

>input (2506 residues)
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNVNELRCGSVNASNQTEVEFS
SIKDEFAIAEDLSGQNATSLGTGGYYGHSPGYYGQHIAANPKPTNKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEGSSSGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNNLKETTAPPPAPAPMPDPVVPPVSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSLRQQQEGTNLPDVPNKSAPSPTSNS
TYLTMNAASREIPNTTVSNFRGSMGNSIMRPNSSASKFSPMSYPQMKPKSPHNSGLVNLT
ERSRYGMTDMTNSSADLETNSMLNDSSSDEELNEIDSENGLSAMDHQTSGLSAEQLMGSD
GNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTCK
SSLKLGAHKQCHTGTTSDWDAVNSQSESISSSLNEGVVSYESSSINGRKSGVMLDPLQQQ
QPPQPPPPPPPPPPSQPQPLQQPQPPQLQPPHQVPPQPQTQPPPTQQPQPPTQAAPLHPY
KCTMCNYSTTTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENETDSHPSSSNTVKKSQT
SILGLSSKNNFVAKASRKLANDFPLDLSPVKKRTRIDEIASNLQSKINQTKQQEDAVINV
EDDEEEEEDNEVEIEVELDREEEPTEPIIEVPTSFSAQQIWVRDTSEPQKEPNFRNITHD
YNATNGAEIELTLSEDEEDYYGSSTNLKDHQVSNTALLNTQTPIYGTEHNSENTDFGDSG
RLYYCKHCDFNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFED
LQQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFS
SYVVEQQEGLNTESQTLREILNSAPKNMATSTPVARGGGLPATFNKNTPKTFTPECENQK
DPLVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSALSQ
LSFEVGAPMSPKMSNMGSPPPPQPPPPDLSTELYYCKHCSYSNRSVVGVLVHYQKRHPEI
KVTAKYIRQAPPTAAMMRGVEGPQGSPRPPAPIQQLNRSSSERDGPPVENEMFFCQHCDY
GNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKKPASCVLVSPSNLERDKT
KLRALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYS
HTEPNGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSPPSLTMPAEAKTYRCRDCVFEAVS
IWDITNHYQAFHPWAMNGDESVLLDIIKEKDAVEKPILSSEELAGPVNCENSIPTPFPEQ
EAECPEDARLSPEKSLQLASANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKA
ADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPSIKVTAEDFVHDVEQSADISQ
NDVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSQSPPKLPVPLE
PEMTTEVSPSQVSITEEEVGEEPVSTSHFSTSHLVSHTVFRCQLCKYFCSTRKGIARHYR
IKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKP
NKVIIPSPPKDDSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQHA
SKLGGYFTAVYADEHEKPTLMEEEERGNFEKAEVEGEAQEIEWLPFRCIKCFKLSFSTAE
LLCMHYTDHHSRDLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQK
RAKRQERRKQLLSKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHPTL
RAICNHLRKHVQYGNVPAVSAAVKGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHNL
DRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQLKE
HSLKVHGKALTLPRPRIVSLLSSHSHHSSQKATPAEEVEDSNDSSYSEPPDVQQQLNHYQ
SAALARNNSRVSPVPLSGAAAGTEQKTEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLF
KCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREER
VVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHT
EELDSHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKEEEMNSKAEDRELMR
FSDHGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENS
VKMPSIEEKEDDEAIGIDFSLKNETVAICVVTADKSLLENAEAKKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JM2	1.000	1.000	0.000	2506	1.000	1.000	Q96JM2.pdb.gz	ZN462_HUMAN Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3
2	AFDB:A0A0K3AUE4	0.034	0.039	6.311E-9	1968	0.119	0.151	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
3	AFDB:Q9VPQ6	0.039	0.047	5.180E-8	1191	0.077	0.161	Q9VPQ6.pdb.gz	USH_DROME Zinc finger protein ush OS=Drosophila melanogaster OX=7227 GN=ush PE=1 SV=2
4	AFDB:Q13029	0.028	0.038	8.427E-7	1718	0.094	0.137	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
5	AFDB:A2A7B5	0.030	0.037	2.980E-6	1709	0.095	0.140	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
6	AFDB:A1ZAV3	0.034	0.038	8.100E-6	2171	0.114	0.131	A1ZAV3.pdb.gz	A1ZAV3_DROME Misexpression suppressor of ras 4, isoform A OS=Drosophila melanogaster OX=7227 GN=MESR4 PE=1 SV=1
7	AFDB:Q7TSH3	0.029	0.047	1.301E-5	1157	0.076	0.164	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
8	AFDB:Q90ZW5	0.037	0.056	1.982E-5	1261	0.088	0.174	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
9	AFDB:Q9H0D2	0.036	0.050	7.387E-5	1346	0.077	0.143	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
10	AFDB:D4A0R1	0.027	0.047	1.186E-4	1090	0.060	0.139	D4A0R1.pdb.gz	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
11	PDB:3w5kB	0.021	0.220	1.390E-1	110	0.013	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:3javA	0.034	0.031	2.383	2327	0.101	0.109	3javA.pdb.gz
13	PDB:5io3A	0.015	0.083	2.941	385	0.003	0.018	5io3A.pdb.gz
14	PDB:3ul5D	0.013	0.178	3.268	84	0.004	0.119	3ul5D.pdb.gz
15	PDB:6oidA	0.009	0.049	3.268	289	0.003	0.024	6oidA.pdb.gz	A redox-active switch in fructosamine-3-kinases expands the regulatory repertoire of the protein kinase superfamily.
16	PDB:7v6cB	0.020	0.130	3.445	260	0.002	0.019	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
17	PDB:7pmkQ	0.015	0.034	4.252	766	0.006	0.021	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7a094	0.015	0.143	4.724	144	0.003	0.056	7a094.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
19	PDB:4c2mI	0.018	0.131	5.248	124	0.008	0.161	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
20	PDB:4v6wCo	0.012	0.122	5.248	104	0.004	0.096	4v6wCo.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AWL2	0.0	3672	2495	0.715	0.718	ZN462_MOUSE Zinc finger protein 462 OS=Mus musculus OX=10090 GN=Znf462 PE=1 SV=1
2	Q96JM2	0.0	5255	2506	1.000	1.000	ZN462_HUMAN Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3
3	R4GDS0	8.66e-24	110	548	0.046	0.212	R4GDS0_DANRE Zinc finger protein 513a OS=Danio rerio OX=7955 GN=cb557 PE=4 SV=1
4	Q99KE8	7.21e-18	92.8	643	0.044	0.173	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
5	Q9NTW7	3.82e-17	90.5	645	0.044	0.172	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
6	Q6PD29	3.72e-15	83.6	541	0.036	0.168	ZN513_MOUSE Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2
7	Q05481	4.86e-14	80.9	1191	0.062	0.130	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	P17012	1.01e-12	76.3	799	0.040	0.125	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2
9	P17010	1.06e-12	76.3	805	0.040	0.124	ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2
10	Q6JAA4	1.81e-12	75.5	798	0.033	0.103	Q6JAA4_DANRE CCCTC-binding factor OS=Danio rerio OX=7955 GN=im:7152666 PE=1 SV=1
11	E9PEP7	1.83e-12	75.5	755	0.040	0.132	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
12	Q7TS63	3.38e-12	75.1	1237	0.030	0.061	ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus OX=10090 GN=Zfat PE=1 SV=2
13	P08048	1.32e-11	72.8	801	0.040	0.124	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
14	Q86WZ6	1.50e-11	72.8	799	0.052	0.164	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
15	Q9Y462	2.14e-11	72.0	761	0.037	0.122	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
16	Q08705	2.17e-11	72.0	728	0.032	0.111	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
17	Q5TYW1	2.84e-11	72.0	1059	0.052	0.123	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
18	Q9R1D1	3.03e-11	71.6	737	0.031	0.106	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
19	Q5DTF8	3.05e-11	71.6	919	0.066	0.180	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
20	Q61164	3.26e-11	71.2	736	0.031	0.106	CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus OX=10090 GN=Ctcf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	94	14.9	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	73	15.6	C2H2-type zinc finger
3	PF13909 zf-H2C2_5	0.0023	28.9	C2H2-type zinc-finger domain
4	PF18387 zf_C2H2_ZHX	25	16.0	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000277225

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383920	0.910	Putative Polycomb group protein ASXL2
2	9606.ENSP00000358207	0.907	Ventral anterior homeobox 1
3	9606.ENSP00000350708	0.731	UV excision repair protein RAD23 homolog B
4	9606.ENSP00000415056	0.713	piRNA biogenesis protein EXD1
5	9606.ENSP00000311679	0.707	Zinc finger protein 483
6	9606.ENSP00000358064	0.668	Regulation of nuclear pre-mRNA domain containing 2
7	9606.ENSP00000249344	0.640	Striatin-interacting protein 2
8	9606.ENSP00000363382	0.587	Sushi domain containing 1
9	9606.ENSP00000379208	0.586	Zinc finger protein 248
10	9606.ENSP00000351346	0.581	Vacuolar protein sorting-associated protein 13B
11	9606.ENSP00000381666	0.554	Glucoside xylosyltransferase 1
12	9606.ENSP00000338276	0.553	Cysteine-rich secretory protein 1
13	9606.ENSP00000450857	0.549	Stonin-2
14	9606.ENSP00000354730	0.545	Chromosome alignment-maintaining phosphoprotein 1
15	9606.ENSP00000421246	0.543	Zinc finger protein 131
16	9606.ENSP00000405890	0.539	Pre-B-cell leukemia transcription factor 1
17	9606.ENSP00000364678	0.522	Histone-lysine N-methyltransferase EHMT2
18	9606.ENSP00000290607	0.514	StAR-related lipid transfer protein 9
19	9606.ENSP00000209875	0.509	Chromobox protein homolog 5
20	9606.ENSP00000476499	0.501	Zinc finger and BTB domain-containing protein 8B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.742	heterocyclic compound binding
GO:0097159	0.741	organic cyclic compound binding
GO:0003676	0.633	nucleic acid binding
GO:0003677	0.553	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0016043	0.982	cellular component organization
GO:0031323	0.966	regulation of cellular metabolic process
GO:0006355	0.958	regulation of DNA-templated transcription
GO:0051173	0.929	positive regulation of nitrogen compound metabolic process
GO:0010604	0.926	positive regulation of macromolecule metabolic process
GO:0031325	0.925	positive regulation of cellular metabolic process
GO:0051101	0.900	regulation of DNA binding
GO:0045893	0.877	positive regulation of DNA-templated transcription
GO:0044092	0.636	negative regulation of molecular function
GO:0006325	0.616	chromatin organization
GO:0051100	0.507	negative regulation of binding
GO:0043392	0.497	negative regulation of DNA binding
GO:0006357	0.480	regulation of transcription by RNA polymerase II
GO:0045944	0.424	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.886	intracellular organelle lumen
GO:0031981	0.881	nuclear lumen
GO:0005654	0.809	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]