StarFunc result for job id Q96JM3

User Input

>input (812 residues)
MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAK
LFHCHKCFFTSKMYSNVYYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCN
SAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPA
SVSSPEPPKSVPVCESQKLAPVPSPEPQKPAPVSPESVKATLSNPKPQKQSHFPETLGPP
SASSPESPVLAASPEPWGPSPAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP
RRPAPAVSPGSWKPGPPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKPIPSVSPGPWK
PTPSVSSASWKSSSVSPSSWKSPPASPESWKSGPPELRKTAPTLSPEHWKAVPPVSPELR
KPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQRKTSPASLDFPESQKSSRGGSPDLW
KSSFFIEPQKPVFPETRKPGPSGPSESPKAASDIWKPVLSIDTEPRKPALFPEPAKTAPP
ASPEARKRALFPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEEL
LASPKKLLEDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQESSSDQEQVDV
ESIDFSKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAMK
KGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRGF
KKHLTHCQSRHNEEANKKLMEALEPPLEEQQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JM3	0.999	0.999	0.000	812	1.000	1.000	Q96JM3.pdb.gz	CHAP1_HUMAN Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2
2	AFDB:B8A5T9	0.086	0.077	4.808E-5	927	0.180	0.157	B8A5T9.pdb.gz
3	AFDB:M9NEG1	0.106	0.081	7.284E-4	1109	0.137	0.100	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
4	AFDB:A0A1W2PQA1	0.065	0.054	8.845E-4	1069	0.164	0.124	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
5	AFDB:Q7KHG2	0.057	0.037	1.146E-3	1486	0.170	0.093	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
6	AFDB:A2A7B5	0.059	0.041	2.051E-3	1709	0.192	0.091	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
7	AFDB:Q5A4H5	0.087	0.095	3.025E-3	731	0.140	0.156	Q5A4H5.pdb.gz	CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRZ1 PE=1 SV=1
8	AFDB:Q13127	0.060	0.052	4.460E-3	1097	0.161	0.119	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
9	AFDB:Q8I7Z8	0.115	0.097	4.758E-3	990	0.153	0.125	Q8I7Z8.pdb.gz	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
10	AFDB:Q8VIG1	0.062	0.052	5.777E-3	1082	0.188	0.141	Q8VIG1.pdb.gz	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
11	PDB:3w5kB	0.067	0.291	9.234E-2	110	0.030	0.218	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5aj0Ap	0.045	0.251	9.488E-1	91	0.016	0.143	5aj0Ap.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
13	PDB:2b3tB	0.036	0.084	1.152	300	0.010	0.027	2b3tB.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
14	PDB:5dkaA	0.039	0.258	1.699	96	0.011	0.094	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:5gm6I	0.039	0.270	1.812	102	0.015	0.118	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:3mhhC	0.037	0.247	2.063	93	0.015	0.129	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
17	PDB:6gejS	0.034	0.099	2.063	208	0.020	0.077	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	PDB:7b93R	0.032	0.169	2.200	96	0.016	0.135	7b93R.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
19	PDB:7o4iB	0.037	0.029	2.348	1180	0.016	0.011	7o4iB.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
20	PDB:4btsA9	0.034	0.245	2.505	93	0.018	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96JM3	0.0	1605	812	1.000	1.000	CHAP1_HUMAN Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2
2	A0A2R8Y735	3.97e-135	400	194	0.239	1.000	A0A2R8Y735_HUMAN Chromosome alignment-maintaining phosphoprotein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=1
3	A0A0C4DHB7	1.57e-06	54.7	1943	0.030	0.012	A0A0C4DHB7_DROME Molting defective, isoform E OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
4	A0A0B4K7S6	1.81e-06	54.3	1965	0.030	0.012	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
5	A2A761	1.32e-05	51.2	587	0.034	0.048	ZFP69_MOUSE Zinc finger protein 69 OS=Mus musculus OX=10090 GN=Zfp69 PE=3 SV=1
6	F1QWQ9	1.89e-04	47.4	568	0.030	0.042	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1
7	Q9UL36	2.04e-04	47.8	1845	0.047	0.021	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
8	Q5T1R4	2.36e-04	47.4	2406	0.030	0.010	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
9	F1QMZ5	2.42e-04	47.4	1190	0.037	0.025	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
10	P17010	2.61e-04	47.0	805	0.032	0.032	ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2
11	Q6XSK8	2.63e-04	47.0	517	0.030	0.046	Q6XSK8_DANRE PR domain zinc finger protein 14 OS=Danio rerio OX=7955 GN=wu:fc16b12 PE=4 SV=2
12	F1QBD3	2.67e-04	47.0	1176	0.037	0.026	F1QBD3_DANRE Zinc finger E-box-binding homeobox 1 isoform X2 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
13	E9PEP7	3.95e-04	46.6	755	0.032	0.034	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
14	P17012	4.09e-04	46.6	799	0.032	0.033	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2
15	P10074	5.05e-04	46.2	688	0.032	0.038	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
16	O43167	5.81e-04	45.8	697	0.037	0.043	ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens OX=9606 GN=ZBTB24 PE=1 SV=2
17	A7Y7X5	6.44e-04	45.8	761	0.030	0.032	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
18	A2A884	6.61e-04	45.8	2348	0.028	0.010	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
19	Q9DEH7	6.76e-04	45.8	1078	0.050	0.038	Q9DEH7_DANRE Kheper OS=Danio rerio OX=7955 GN=kheper PE=1 SV=1
20	Q9Y462	8.54e-04	45.4	761	0.034	0.037	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	6.5e+02	12.2	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	38	16.5	C2H2-type zinc finger
3	PF13909 zf-H2C2_5	2.2e+02	13.0	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000235310	0.973	Mitotic spindle assembly checkpoint protein MAD2B
2	9606.ENSP00000271715	0.970	Pogo transposable element with ZNF domain
3	9606.ENSP00000377060	0.854	Chromobox protein homolog 1
4	9606.ENSP00000368100	0.835	DNA repair protein RAD50
5	9606.ENSP00000336687	0.828	Chromobox protein homolog 3
6	9606.ENSP00000209875	0.741	Chromobox protein homolog 5
7	9606.ENSP00000325863	0.683	Double-strand break repair protein MRE11
8	9606.ENSP00000464780	0.673	Tubulin polyglutamylase complex subunit 2
9	9606.ENSP00000322716	0.669	Putative oxidoreductase GLYR1
10	9606.ENSP00000229903	0.638	SAYSVFN motif domain containing 1
11	9606.ENSP00000359160	0.631	tRNA:m(4)X modification enzyme TRM13 homolog
12	9606.ENSP00000326879	0.629	UPF0489 protein C5orf22
13	9606.ENSP00000369465	0.626	Gamma-taxilin
14	9606.ENSP00000360329	0.623	Tetratricopeptide repeat domain containing
15	9606.ENSP00000355944	0.598	Kinetochore-associated protein NSL1 homolog
16	9606.ENSP00000475594	0.563	Zinc finger protein 462
17	9606.ENSP00000277225	0.545	Zinc finger protein 462
18	9606.ENSP00000216452	0.506	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.434	heterocyclic compound binding
GO:0097159	0.433	organic cyclic compound binding
GO:0003676	0.413	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0022402	0.986	cell cycle process
GO:0006996	0.985	organelle organization
GO:0051276	0.979	chromosome organization
GO:0000280	0.974	nuclear division
GO:1903047	0.971	mitotic cell cycle process
GO:0000070	0.962	mitotic sister chromatid segregation
GO:0051179	0.907	localization
GO:0034502	0.902	protein localization to chromosome
GO:0051303	0.899	establishment of chromosome localization
GO:0008608	0.883	attachment of spindle microtubules to kinetochore
GO:0071459	0.883	protein localization to chromosome, centromeric region
GO:0007080	0.879	mitotic metaphase plate congression
GO:0044380	0.872	protein localization to cytoskeleton
GO:0051315	0.872	attachment of mitotic spindle microtubules to kinetochore
GO:1903083	0.831	protein localization to condensed chromosome
GO:0031134	0.826	sister chromatid biorientation
GO:0050789	0.787	regulation of biological process
GO:0072698	0.752	protein localization to microtubule cytoskeleton
GO:0050794	0.741	regulation of cellular process
GO:0034501	0.740	protein localization to kinetochore
GO:0019222	0.423	regulation of metabolic process
GO:0060255	0.408	regulation of macromolecule metabolic process
GO:0080090	0.379	regulation of primary metabolic process
GO:0051171	0.379	regulation of nitrogen compound metabolic process
GO:0031323	0.308	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0098687	0.996	chromosomal region
GO:0005856	0.995	cytoskeleton
GO:0030496	0.994	midbody
GO:0016604	0.991	nuclear body
GO:0000775	0.990	chromosome, centromeric region
GO:0099080	0.981	supramolecular complex
GO:0005819	0.980	spindle
GO:0090543	0.977	Flemming body
GO:0000793	0.971	condensed chromosome
GO:0000776	0.961	kinetochore
GO:0032991	0.847	protein-containing complex
GO:0005737	0.733	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]