StarFunc result for job id Q96JM4

User Input

>input (1722 residues)
MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINII
KNRSKAVEELILQDLEDTDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKE
EFMRSKTDCATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKE
LEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQKQEQDKMNDELYKEE
KIWKEKFKQHEEYIRNLHLQMEEERTRFKDQQEKEKNSLLKQQNNAAVKIQAKYKAFVAY
QKYGPIIKEQIESKKRKAQEWKEKEAKIRQKEEENRKRLEEEQRIKEERKKQKEEERKRR
EKEYEEKKNIVKQEREQLISKEKIILREDASQQLIISSALKKSGYNNKHLSLEDISNDKG
DIAKNLVDENSKKQEDVLLWLVEESNMKENVDRQTILKESIQVKLKESISSQTILADFKM
EEKNENLAKKRCSEELVKQERKYENTDNKTELGNSDLKGNLKEQFPLQELKSDAQKEEKI
MKHVINENTGQKTQIILGHNQEISEVKTNEEQKIIKDNQQKKIQKVEKEEIQEQNGLLYK
DKDTLVISVKQRSLSLTSENSKDVRENVILQEKEIYSKSKEIEENPKDNAWNSGIVIFNT
TDTMINIEGKRNDQDYVLGRHAPCEGLSNYNAESSMVSKEVNSLKSEIRNISEKCHENAP
EPDSMTCCVSESTLLYSIEERRLAWIKSFKPWLEIFKQNQQKKIVRRKRPVKCPANMTPA
LDKLEILRCGPWDTLQQVTTVTFQDLPGCVLSTLAECTNLQFLSLRRCGLTSLHSLSNCK
KLKYIDAQENHIEAIECENLENLCVVLLNKNQLTSLHGLDGCTNIQCLELSYNKITRIGY
SFFLEEKLVDNAGFCHHLGTSTSYLSLAQVWIPTGLCWSWIPITSLTKNSDCNFLISHLY
WNCGLESLKNLQQLILDHNQLINTKGLCDTPTIVYLDCSHNHLTDVEGVENCGLLQILKL
QGNYLSELPSLENLVLLRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLTKIVPLFHF
VSLEKLDVSHNCLSDLKSAIKWFDACYSLHELSLTGNPLLQETNWRDSLLKVLPALRILN
GNILNSNSESRTEEHNQLGSAGFLALCQSQIREFNLLIENYITGKGDVFTLDTAENLCHY
FKKLMILSTEYRHAHERGDVTITKKDESEAQKNHLAPTNSDSTLQNGVFYSCAREGEPDS
PDIPEKWMDSVSSHSPLSKSATCENMEGRHQEILVCQKREDSKASSIPTIRIPFKEVVMT
NSLLRNHQNIEPSEKIMAAVVIQSYWRGYLMRRQTHFSTRLHTAATEGLPNSSIKNQTIL
KKGKRENIVNIRKQREKAAILIQAVWKGFILRKKLTTALEAIKNEESDEEYREIDLEDFI
FDEAALEEEWLALDSTRFPSQTLLLSNQLHWPKIPGNLKWDDTSFNLPSNPAQAWLCNDK
ENLSSSEHTQFNSRSENKTSSWTPESKTSRKSLLKSEKEKKISEEWGFKDISTAQQMLKR
AQKMKSKKLKKKIDSTVRLALFKNNENKVSLPKSPKMVQPRRDGYFEGIEEDPIHKDTTA
NEKLERNREYTYQWLHTQVGVHETTSSRNMKCNHFLPELDPDVLNGGRVQLVARLVSRED
TDLDLFSMTNGSALSVNREKKNQAHRHSAGSSSKLWFPSKLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6hkwA	0.157	0.822	2.641E-13	306	0.042	0.235	6hkwA.pdb.gz
2	AFDB:P70587	0.143	0.163	4.364E-9	1490	0.098	0.113	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
3	PDB:7tvfD	0.123	0.328	8.905E-9	515	0.049	0.163	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
4	PDB:5yq5B	0.129	0.614	1.363E-8	306	0.030	0.167	5yq5B.pdb.gz
5	PDB:6gffI	0.127	0.375	7.885E-8	551	0.042	0.132	6gffI.pdb.gz
6	PDB:5xjxC	0.122	0.495	1.847E-7	365	0.041	0.195	5xjxC.pdb.gz
7	AFDB:Q80TH2	0.141	0.170	2.622E-7	1402	0.076	0.093	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
8	PDB:1xcdA	0.135	0.672	2.680E-7	305	0.035	0.200	1xcdA.pdb.gz
9	PDB:2ft3F	0.127	0.636	2.023E-6	305	0.033	0.184	2ft3F.pdb.gz
10	PDB:3t6qA	0.106	0.241	2.783E-6	601	0.053	0.153	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
11	PDB:7wv3A	0.107	0.205	2.935E-6	668	0.054	0.139	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
12	PDB:7lt9A	0.106	0.600	3.096E-6	251	0.028	0.191	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
13	AFDB:Q7JWP9	0.097	0.158	3.553E-6	915	0.078	0.146	Q7JWP9.pdb.gz	Q7JWP9_DROME RE09008p OS=Drosophila melanogaster OX=7227 GN=tartan/capricious-like PE=1 SV=1
14	AFDB:Q9T0K5	0.104	0.218	2.938E-4	760	0.051	0.114	Q9T0K5.pdb.gz	LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=LRX3 PE=1 SV=1
15	AFDB:Q9LJ64	0.108	0.180	1.110E-3	956	0.056	0.100	Q9LJ64.pdb.gz	PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=1 SV=1
16	AFDB:Q38EZ3	0.037	0.045	1.699E-3	1346	0.082	0.105	Q38EZ3.pdb.gz	Q38EZ3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4120 PE=4 SV=1
17	AFDB:F4JXK3	0.053	0.082	3.980E-3	1018	0.071	0.120	F4JXK3.pdb.gz	F4JXK3_ARATH Branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) OS=Arabidopsis thaliana OX=3702 GN=ATBCAT-5 PE=1 SV=1
18	AFDB:F8VPZ9	0.029	0.031	1.283E-2	1578	0.077	0.084	F8VPZ9.pdb.gz	BICRA_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein OS=Mus musculus OX=10090 GN=Bicra PE=1 SV=1
19	AFDB:E1JJ76	0.029	0.040	1.353E-2	1165	0.096	0.142	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
20	AFDB:Q9W3Q5	0.035	0.045	1.505E-2	1268	0.088	0.119	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8KC98	8.24e-11	69.7	1102	0.042	0.065	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
2	Q6ZRR7	1.87e-10	68.6	1453	0.028	0.033	LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=LRRC9 PE=2 SV=2
3	P0DJM0	1.63e-09	65.5	800	0.031	0.068	INLA_LISMO Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
4	Q8IW35	2.13e-08	61.6	865	0.030	0.060	CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens OX=9606 GN=CEP97 PE=1 SV=1
5	Q9CZ62	1.20e-07	59.3	856	0.029	0.058	CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus OX=10090 GN=Cep97 PE=1 SV=1
6	Q9U3W5	2.06e-07	57.4	326	0.043	0.227	Q9U3W5_DROME Putative mitotic protein phosphatase 1 regulator OS=Drosophila melanogaster OX=7227 GN=sds22 PE=2 SV=1
7	Q9VQV7	2.32e-07	58.2	806	0.029	0.062	Q9VQV7_DROME Centrosomal protein 97kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep97 PE=3 SV=3
8	Q8INT5	3.16e-07	58.2	1483	0.025	0.029	DAAF1_DROME Dynein axonemal assembly factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=dtr PE=2 SV=2
9	Q9VEK8	3.28e-07	56.6	326	0.042	0.221	Q9VEK8_DROME GH07711p OS=Drosophila melanogaster OX=7227 GN=sds22 PE=1 SV=1
10	Q15435	4.62e-07	56.2	360	0.028	0.136	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
11	A1JU68	4.89e-07	56.2	367	0.037	0.172	A1JU68_YERE8 Yop type III secretion system effector protein OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=yopM PE=1 SV=1
12	Q96M69	7.88e-07	56.6	825	0.038	0.079	LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens OX=9606 GN=LRGUK PE=1 SV=1
13	Q8IUZ0	7.93e-07	56.6	686	0.028	0.071	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
14	Q385P9	1.35e-06	56.2	1498	0.052	0.059	Q385P9_TRYB2 Protein phosphatase 1 regulatory subunit 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2850 PE=3 SV=1
15	Q3UM45	1.74e-06	54.7	361	0.027	0.130	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
16	P12024	2.14e-06	55.5	1315	0.052	0.068	CHAO_DROME Chaoptin OS=Drosophila melanogaster OX=7227 GN=chp PE=1 SV=2
17	Q9D5S7	3.84e-06	54.3	820	0.039	0.082	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1
18	A1Z9N6	4.08e-06	54.3	1092	0.050	0.079	A1Z9N6_DROME Acid labile subunit OS=Drosophila melanogaster OX=7227 GN=conv PE=2 SV=2
19	Q80TM9	4.32e-06	54.3	1593	0.033	0.035	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
20	O35125	7.87e-06	52.4	340	0.042	0.212	LRC23_MOUSE Leucine-rich repeat-containing protein 23 OS=Mus musculus OX=10090 GN=Lrrc23 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00612 IQ	1.6e-10	50.8	IQ calmodulin-binding motif
2	PF12799 LRR_4	1e-14	65.6	Leucine Rich repeats (2 copies)
3	PF13855 LRR_8	1.6e-08	45.5	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310829	0.736	Cilia- and flagella-associated protein 70
2	9606.ENSP00000219299	0.730	Coiled-coil domain-containing protein 113
3	9606.ENSP00000377668	0.727	Sulfite oxidase, mitochondrial
4	9606.ENSP00000390932	0.676	Leucine-rich repeat-containing protein 23
5	9606.ENSP00000339449	0.667	Cilia- and flagella-associated protein 52
6	9606.ENSP00000357079	0.665	Cilia and flagella associated protein 45
7	9606.ENSP00000364568	0.653	Putative uncharacterized protein C9orf129
8	9606.ENSP00000331044	0.627	Enkurin
9	9606.ENSP00000433816	0.610	Putative tetraspanin-19
10	9606.ENSP00000357682	0.604	Fibronectin type 3 and ankyrin repeat domains protein 1
11	9606.ENSP00000343521	0.601	Olfactory receptor 1J4
12	9606.ENSP00000405708	0.563	Coiled-coil domain-containing protein 39
13	9606.ENSP00000337804	0.560	Sperm-associated antigen 17
14	9606.ENSP00000297814	0.558	Kinesin-like protein KIF27
15	9606.ENSP00000377197	0.556	Hydrocephalus-inducing protein homolog
16	9606.ENSP00000395835	0.549	Coiled-coil domain containing 129
17	9606.ENSP00000360296	0.533	Phospholipid phosphatase 3
18	9606.ENSP00000360107	0.532	EF-hand domain-containing protein 1
19	9606.ENSP00000353048	0.512	T-complex protein 1 subunit theta-like 2
20	9606.ENSP00000263640	0.504	Activin receptor type-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048518	0.340	positive regulation of biological process
GO:0048522	0.328	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0031981	0.989	nuclear lumen
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005856	0.974	cytoskeleton
GO:0005654	0.960	nucleoplasm
GO:0015630	0.412	microtubule cytoskeleton
GO:0005576	0.310	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]