StarFunc result for job id Q96JN0

User Input

>input (433 residues)
MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMAD
QDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYR
PDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGL
QNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQD
GKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQS
RKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISV
VMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQ
GEAAQSANESKNE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZPI3	0.247	0.247	1.453E-55	433	0.979	0.979	Q6ZPI3.pdb.gz	LCOR_MOUSE Ligand-dependent corepressor OS=Mus musculus OX=10090 GN=Lcor PE=2 SV=2
2	AFDB:Q95YM8	0.122	0.041	4.423E-3	1598	0.208	0.056	Q95YM8.pdb.gz	MBLK1_APIME Mushroom body large-type Kenyon cell-specific protein 1 OS=Apis mellifera OX=7460 GN=Mblk-1 PE=1 SV=1
3	AFDB:Q0J235	0.102	0.086	2.252E-2	532	0.159	0.130	Q0J235.pdb.gz	ROLL9_ORYSJ Probable transcription factor RL9 OS=Oryza sativa subsp. japonica OX=39947 GN=RL9 PE=2 SV=2
4	AFDB:B7Z0K1	0.076	0.036	1.695E-1	1137	0.164	0.062	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
5	PDB:7fbyA	0.087	0.220	3.679E-1	153	0.032	0.092	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
6	PDB:2cyyA	0.088	0.225	3.926E-1	151	0.028	0.079	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
7	AFDB:Q14004	0.062	0.023	4.218E-1	1512	0.178	0.051	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
8	AFDB:Q14693	0.077	0.043	4.502E-1	890	0.164	0.080	Q14693.pdb.gz	LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2
9	AFDB:Q494P4	0.063	0.047	5.473E-1	607	0.182	0.130	Q494P4.pdb.gz	Q494P4_ARATH At2g40070 OS=Arabidopsis thaliana OX=3702 GN=BPP1 PE=1 SV=1
10	AFDB:F1R9K1	0.081	0.074	7.102E-1	511	0.129	0.110	F1R9K1.pdb.gz
11	AFDB:G5EGT0	0.071	0.038	7.102E-1	1019	0.178	0.076	G5EGT0.pdb.gz	G5EGT0_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
12	AFDB:Q9NJB5	0.079	0.039	7.580E-1	1081	0.194	0.078	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
13	PDB:2vbwA	0.078	0.203	9.153E-1	147	0.021	0.061	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
14	PDB:2cg4A	0.087	0.219	1.043	149	0.016	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
15	PDB:1l3lB	0.086	0.153	1.268	233	0.009	0.017	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.
16	PDB:5iy7M	0.087	0.119	1.444	310	0.023	0.032	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
17	PDB:5mrc66	0.094	0.130	1.444	305	0.016	0.023	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:3szpA	0.082	0.118	1.541	290	0.018	0.028	3szpA.pdb.gz
19	PDB:4fx0B	0.071	0.184	1.541	135	0.021	0.067	4fx0B.pdb.gz
20	PDB:4ldzA	0.073	0.147	1.645	196	0.018	0.041	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZPI3	0.0	862	433	0.979	0.979	LCOR_MOUSE Ligand-dependent corepressor OS=Mus musculus OX=10090 GN=Lcor PE=2 SV=2
2	Q96JN0	0.0	879	433	1.000	1.000	LCOR_HUMAN Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR PE=1 SV=2
3	Q3U285	8.80e-46	169	600	0.370	0.267	LCORL_MOUSE Ligand-dependent nuclear receptor corepressor-like protein OS=Mus musculus OX=10090 GN=Lcorl PE=2 SV=1
4	Q8N3X6	3.44e-45	167	602	0.372	0.267	LCORL_HUMAN Ligand-dependent nuclear receptor corepressor-like protein OS=Homo sapiens OX=9606 GN=LCORL PE=1 SV=4
5	A0A0B4KHV1	6.00e-13	73.6	1188	0.095	0.035	A0A0B4KHV1_DROME Ecdysone-induced protein 93F, isoform C OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=4 SV=1
6	Q9VD60	6.40e-13	73.2	1165	0.095	0.035	Q9VD60_DROME Ecdysone-induced protein 93F, isoform A OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=3
7	Q7YU18	7.41e-13	73.2	1188	0.095	0.035	Q7YU18_DROME Ecdysone-induced protein 93F, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
8	Q95YM8	1.47e-12	72.4	1598	0.085	0.023	MBLK1_APIME Mushroom body large-type Kenyon cell-specific protein 1 OS=Apis mellifera OX=7460 GN=Mblk-1 PE=1 SV=1
9	A4UZC9	0.002	42.7	639	0.048	0.033	A4UZC9_DROME Pipsqueak, isoform J OS=Drosophila melanogaster OX=7227 GN=psq PE=1 SV=1
10	A1Z8A6	0.003	42.4	1123	0.048	0.019	A1Z8A6_DROME Pipsqueak, isoform M OS=Drosophila melanogaster OX=7227 GN=psq PE=1 SV=2
11	Q0E9C8	0.003	42.7	645	0.048	0.033	Q0E9C8_DROME Pipsqueak, isoform D OS=Drosophila melanogaster OX=7227 GN=psq PE=1 SV=1
12	Q24457	0.003	42.4	660	0.048	0.032	Q24457_DROME Pipsqueak protein OS=Drosophila melanogaster OX=7227 GN=psq PE=4 SV=1
13	Q7JP00	0.003	42.7	646	0.048	0.033	Q7JP00_DROME PsqB OS=Drosophila melanogaster OX=7227 GN=psq PE=2 SV=1
14	Q7K0T7	0.003	42.4	1064	0.048	0.020	Q7K0T7_DROME LD33470p OS=Drosophila melanogaster OX=7227 GN=psq PE=1 SV=1
15	Q9V5N1	0.003	42.4	1065	0.048	0.020	Q9V5N1_DROME PsqA OS=Drosophila melanogaster OX=7227 GN=psq PE=2 SV=2
16	A0A126GUM1	0.004	42.4	1043	0.048	0.020	A0A126GUM1_DROME Pipsqueak, isoform N OS=Drosophila melanogaster OX=7227 GN=psq PE=1 SV=1
17	A1Z8A4	0.004	42.0	1046	0.048	0.020	A1Z8A4_DROME Pipsqueak, isoform A OS=Drosophila melanogaster OX=7227 GN=psq PE=1 SV=1
18	Q7JN04	0.004	42.0	1085	0.048	0.019	Q7JN04_DROME Pipsqueak protein OS=Drosophila melanogaster OX=7227 GN=psq PE=4 SV=1
19	P14083	0.45	35.4	1046	0.039	0.016	LOV_DROME Protein jim lovell OS=Drosophila melanogaster OX=7227 GN=lov PE=2 SV=2
20	A0A0B4KFC4	0.80	34.7	680	0.053	0.034	A0A0B4KFC4_DROME Ribbon, isoform C OS=Drosophila melanogaster OX=7227 GN=rib PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05225 HTH_psq	6.1e-11	53.2	helix-turn-helix, Psq domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.971	Estrogen receptor
2	9606.ENSP00000290921	0.936	C-terminal-binding protein 1
3	9606.ENSP00000311825	0.909	C-terminal-binding protein 2
4	9606.ENSP00000334061	0.823	Histone deacetylase 6
5	9606.ENSP00000359321	0.797	Metal-response element-binding transcription factor 2
6	9606.ENSP00000363640	0.761	PHD finger protein 1
7	9606.ENSP00000419923	0.738	Krueppel-like factor 6
8	9606.ENSP00000383063	0.726	Nuclear receptor-interacting protein 1
9	9606.ENSP00000320147	0.702	Histone-lysine N-methyltransferase EZH2
10	9606.ENSP00000484710	0.652	Scaffold protein that serves as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex: required to fine- tune the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells (ESCs). Plays a key role in genomic regions that display both active and repressive chromatin properties in pluripotent stem cells by sustaining low level expression at PcG target genes: acts by recruiting the elongin BC complex, thereby restricting excessive activity of the PRC2/EED-EZH2 complex. Interaction with USP7 promotes deubiquitination of H2B at promoter si [...]
11	9606.ENSP00000394757	0.634	Zinc finger protein 516
12	9606.ENSP00000399968	0.613	Nuclear receptor coactivator 2
13	9606.ENSP00000404658	0.609	Histone-lysine N-methyltransferase EZH1
14	9606.ENSP00000363638	0.584	Acyl-protein thioesterase 2
15	9606.ENSP00000362592	0.579	Histone-binding protein RBBP4
16	9606.ENSP00000268712	0.573	Nuclear receptor corepressor 1
17	9606.ENSP00000246794	0.558	Transmembrane gamma-carboxyglutamic acid protein 2
18	9606.ENSP00000326933	0.556	SERTA domain-containing protein 2
19	9606.ENSP00000364678	0.536	Histone-lysine N-methyltransferase EHMT2
20	9606.ENSP00000222726	0.533	Homeobox protein Hox-A5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	0.998	transcription regulator activity
GO:0003682	0.998	chromatin binding
GO:0008134	0.998	transcription factor binding
GO:0140297	0.839	DNA-binding transcription factor binding
GO:0061629	0.809	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.778	nuclear receptor binding
GO:0019899	0.746	enzyme binding
GO:1901363	0.639	heterocyclic compound binding
GO:0097159	0.639	organic cyclic compound binding
GO:0003676	0.629	nucleic acid binding
GO:0003712	0.406	transcription coregulator activity
GO:0001221	0.404	transcription coregulator binding
GO:0003677	0.404	DNA binding
GO:0001222	0.342	transcription corepressor binding
GO:0003824	0.337	catalytic activity
GO:0003714	0.313	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048519	0.991	negative regulation of biological process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0009987	0.980	cellular process
GO:0045892	0.975	negative regulation of DNA-templated transcription
GO:0000122	0.960	negative regulation of transcription by RNA polymerase II
GO:0048518	0.869	positive regulation of biological process
GO:0051173	0.862	positive regulation of nitrogen compound metabolic process
GO:0010604	0.862	positive regulation of macromolecule metabolic process
GO:0031325	0.860	positive regulation of cellular metabolic process
GO:0043170	0.773	macromolecule metabolic process
GO:0044238	0.752	primary metabolic process
GO:0006807	0.739	nitrogen compound metabolic process
GO:0051246	0.626	regulation of protein metabolic process
GO:0050896	0.612	response to stimulus
GO:0051716	0.602	cellular response to stimulus
GO:0044237	0.561	cellular metabolic process
GO:0031399	0.445	regulation of protein modification process
GO:0031401	0.425	positive regulation of protein modification process
GO:0071310	0.382	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.680	cytoplasm
GO:0032991	0.662	protein-containing complex
GO:0043228	0.306	non-membrane-bounded organelle
GO:0043232	0.302	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]