StarFunc result for job id Q96JN2

User Input

>input (1154 residues)
MQAMEGEVLLPALYEEEEEEEEEEEEVEEEEEQVQKGGSVGSLSVNKHRGLSLTETELEE
LRAQVLQLVAELEETRELAGQHEDDSLELQGLLEDERLASAQQAEVFTKQIQQLQGELRS
LREEISLLEHEKESELKEIEQELHLAQAEIQSLRQAAEDSATEHESDIASLQEDLCRMQN
ELEDMERIRGDYEMEIASLRAEMEMKSSEPSGSLGLSDYSGLQEELQELRERYHFLNEEY
RALQESNSSLTGQLADLESERTQRATERWLQSQTLSMTSAESQTSEMDFLEPDPEMQLLR
QQLRDAEEQMHGMKNKCQELCCELEELQHHRQVSEEEQRRLQRELKCAQNEVLRFQTSHS
VTQNEELKSRLCTLQKKYDTSQDEQNELLKMQLQLQTELRQLKVMKSTLVENQSEKELLC
RLQKLHLQHQNVTCEKEKLLERQQQLQEELQCHEAELQHLRDTVASFKESNEKDTETHAQ
LQEMKQLYQASKDELERQKHMYDQLEQDLLLCQLELKELKASHPIPEDKGKCANKCDTLL
SRLTELQEKYKASQKEMGQLQMEQCELLEDQRRMQEEQGQLQEELHRLTLPLPKSGLLLK
SQELLTKLEDLCELQLLYQGMQEEQKKLIQNQDCVLKEQLEIHEELRRFKESHFQEVLEN
PDDSKLAKSSKCNRNKQSKLLMEQMQALQVMYDAGQAKQELLQQEQGRLLEERKRLQADL
QLCLEEMQLLQVQSPSIKMSLESYGKSYGSMVPSNENCRKTYDTTVDDNESYYKSYTSTQ
TSSKSFLKSYDSSTSASEAYGKSYCTTSNSSITYKKSYGSTSSSDTCQKSFVSSCTDEEP
AEPEDMERFEEMVVKVLIKLQAVQAMYQISQEEHSQLQEQMEKLLAKQKDLKEELDACER
EFKECMECLEKPMAPQNDKNEIKELQTKLRELQLQYQASMDEQGRLLVVQEQLEGQLQCC
QEELRQLREKRPSVVKEARGKNANKNMNKNANGVKMKKVTKPCSDTSESDLETRKSLEVV
LYYKASQRKLDGLAKEEEKKEEMEEEKKQVKEEAKEQCGDELVAEPADPEEAKSTEDQEE
NEEDKEEEEKEEDSEEEEDDADSSLESPEENNPLRLSESKKSSPTPNPPIFSLPLVGLVV
ISALLWCWWAETSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JN2	1.000	1.000	0.000	1154	1.000	1.000	Q96JN2.pdb.gz	CC136_HUMAN Coiled-coil domain-containing protein 136 OS=Homo sapiens OX=9606 GN=CCDC136 PE=1 SV=3
2	AFDB:Q3TVA9	0.202	0.205	3.135E-83	1136	0.715	0.726	Q3TVA9.pdb.gz	CC136_MOUSE Coiled-coil domain-containing protein 136 OS=Mus musculus OX=10090 GN=Ccdc136 PE=1 SV=2
3	AFDB:E9QD51	0.146	0.368	9.881E-6	429	0.126	0.338	E9QD51.pdb.gz
4	AFDB:E7FCY3	0.137	0.417	1.963E-5	358	0.114	0.369	E7FCY3.pdb.gz	E7FCY3_DANRE Coiled-coil domain-containing 136b OS=Danio rerio OX=7955 GN=ccdc136b PE=4 SV=1
5	AFDB:P54697	0.112	0.064	5.025E-3	2245	0.146	0.075	P54697.pdb.gz	MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoJ PE=3 SV=2
6	AFDB:O75334	0.063	0.059	7.273E-3	1257	0.135	0.124	O75334.pdb.gz	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
7	AFDB:Q54BP1	0.102	0.069	8.983E-3	2110	0.155	0.085	Q54BP1.pdb.gz	Q54BP1_DICDI Centrosomal protein 248 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293544 PE=4 SV=1
8	AFDB:Q388V1	0.119	0.138	1.110E-2	959	0.169	0.203	Q388V1.pdb.gz	Q388V1_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0560 PE=4 SV=1
9	AFDB:Q5VU43	0.067	0.043	1.233E-2	2346	0.164	0.081	Q5VU43.pdb.gz	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
10	AFDB:F1M8A4	0.084	0.084	1.693E-2	1150	0.113	0.113	F1M8A4.pdb.gz	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
11	PDB:5svaU	0.063	0.282	1.004	156	0.019	0.141	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:7enag	0.065	0.276	1.308	166	0.017	0.120	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:7z37DP1	0.072	0.267	2.888	273	0.040	0.168	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
14	PDB:7unfa	0.062	0.090	3.209	752	0.026	0.040	7unfa.pdb.gz	Molecular basis of mEAK7-mediated human V-ATPase regulation.
15	PDB:1ykhB	0.060	0.307	4.179	114	0.014	0.140	1ykhB.pdb.gz
16	PDB:6r1mB	0.060	0.155	4.179	428	0.014	0.037	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
17	PDB:5oqmi	0.058	0.259	4.406	136	0.018	0.154	5oqmi.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:5n9jE	0.057	0.212	4.896	201	0.020	0.114	5n9jE.pdb.gz
19	PDB:7vgfA	0.044	0.079	4.896	550	0.018	0.038	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
20	PDB:1tjlA	0.057	0.444	5.162	145	0.009	0.069	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TVA9	0.0	1462	1136	0.715	0.726	CC136_MOUSE Coiled-coil domain-containing protein 136 OS=Mus musculus OX=10090 GN=Ccdc136 PE=1 SV=2
2	Q96JN2	0.0	2282	1154	1.000	1.000	CC136_HUMAN Coiled-coil domain-containing protein 136 OS=Homo sapiens OX=9606 GN=CCDC136 PE=1 SV=3
3	E7FCY3	1.08e-26	115	358	0.086	0.277	E7FCY3_DANRE Coiled-coil domain-containing 136b OS=Danio rerio OX=7955 GN=ccdc136b PE=4 SV=1
4	B7Z964	7.71e-18	89.0	362	0.063	0.202	B7Z964_HUMAN cDNA FLJ60222, highly similar to Homo sapiens sarcolemma associated protein (SLMAP), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
5	Q14BN4	5.27e-17	89.0	828	0.063	0.088	SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1
6	Q3URD3	8.45e-12	72.0	845	0.059	0.080	SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus OX=10090 GN=Slmap PE=1 SV=2
7	Q9P1Z2	0.001	45.4	691	0.090	0.151	CACO1_HUMAN Calcium-binding and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CALCOCO1 PE=1 SV=2
8	Q38DW1	0.15	38.5	726	0.053	0.084	Q38DW1_TRYB2 Spindle assembly abnormal protein 6 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1930 PE=4 SV=1
9	F4I8B9	0.49	37.0	1345	0.071	0.061	Y1501_ARATH Putative WEB family protein At1g65010, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g65010 PE=1 SV=1
10	P03995	1.5	35.0	430	0.063	0.170	GFAP_MOUSE Glial fibrillary acidic protein OS=Mus musculus OX=10090 GN=Gfap PE=1 SV=4
11	P48725	3.7	34.3	2898	0.029	0.011	PCNT_MOUSE Pericentrin OS=Mus musculus OX=10090 GN=Pcnt PE=1 SV=2
12	Q9SHJ6	3.8	33.9	323	0.051	0.183	PMD2_ARATH Peroxisomal and mitochondrial division factor 2 OS=Arabidopsis thaliana OX=3702 GN=PMD2 PE=1 SV=1
13	Q9EQ09	4.3	33.5	363	0.026	0.083	OLR1_MOUSE Oxidized low-density lipoprotein receptor 1 OS=Mus musculus OX=10090 GN=Olr1 PE=2 SV=2
14	Q66GS9	8.0	33.1	1140	0.058	0.059	CP135_HUMAN Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2
15	P14136	9.5	32.7	432	0.057	0.153	GFAP_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	10	17.6	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF13851 GAS	0.43	21.4	Growth-arrest specific micro-tubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274473	0.822	Multiple epidermal growth factor-like domains protein 10
2	9606.ENSP00000367227	0.654	Transmembrane protein 8B
3	9606.ENSP00000335038	0.622	V-set and transmembrane domain containing 2B
4	9606.ENSP00000386908	0.619	Multiple epidermal growth factor-like domains protein 11
5	9606.ENSP00000348982	0.605	Multiple epidermal growth factor-like domains protein 6
6	9606.ENSP00000380251	0.604	Nucleoside diphosphate-linked moiety X motif 19
7	9606.ENSP00000303437	0.545	t-SNARE domain containing 1
8	9606.ENSP00000368152	0.545	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6
9	9606.ENSP00000413035	0.533	RNA binding protein fox-1 homolog 2
10	9606.ENSP00000281523	0.528	Zinc finger protein 385D
11	9606.ENSP00000202017	0.526	P53 and DNA damage-regulated protein 1
12	9606.ENSP00000444503	0.526	Homeobox protein SEBOX
13	9606.ENSP00000347055	0.514	Myosin light chain 4
14	9606.ENSP00000380553	0.505	Tetraspanin-4
15	9606.ENSP00000310668	0.503	Nuclear pore complex protein Nup93
16	9606.ENSP00000378181	0.503	Bromodomain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0022607	0.987	cellular component assembly
GO:0019953	0.959	sexual reproduction
GO:0032504	0.956	multicellular organism reproduction
GO:0048856	0.955	anatomical structure development
GO:0022414	0.953	reproductive process
GO:0048468	0.930	cell development
GO:0010256	0.929	endomembrane system organization
GO:0048609	0.920	multicellular organismal reproductive process
GO:0007276	0.899	gamete generation
GO:0009653	0.896	anatomical structure morphogenesis
GO:0048232	0.866	male gamete generation
GO:0006996	0.840	organelle organization
GO:0065007	0.627	biological regulation
GO:0050789	0.583	regulation of biological process
GO:0070925	0.501	organelle assembly
GO:0022412	0.495	cellular process involved in reproduction in multicellular organism
GO:0003006	0.470	developmental process involved in reproduction
GO:0050794	0.443	regulation of cellular process
GO:0032989	0.402	cellular component morphogenesis
GO:0007281	0.373	germ cell development
GO:0048646	0.354	anatomical structure formation involved in morphogenesis
GO:0007283	0.339	spermatogenesis
GO:0010927	0.336	cellular component assembly involved in morphogenesis
GO:0016050	0.328	vesicle organization
GO:0033363	0.323	secretory granule organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031090	0.995	organelle membrane
GO:0031410	0.995	cytoplasmic vesicle
GO:0098588	0.993	bounding membrane of organelle
GO:0030659	0.992	cytoplasmic vesicle membrane
GO:0005739	0.980	mitochondrion
GO:0099503	0.978	secretory vesicle
GO:0030141	0.969	secretory granule
GO:0030667	0.955	secretory granule membrane
GO:0001669	0.952	acrosomal vesicle
GO:0002080	0.927	acrosomal membrane
GO:0070013	0.385	intracellular organelle lumen
GO:0031981	0.371	nuclear lumen
GO:0005654	0.344	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]