StarFunc result for job id Q96JN8

User Input

>input (1562 residues)
MAAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHPRTGRLVSLSACGRT
ARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSA
TGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGV
AATGLPPRVWAVVDLYGKCTQITVLPPEPGFSPPTPIPTPPLEPLAPTEDSALAEQGTSA
DEAFMVSPAQARPETFPNSLESHNDFANMELSEVVSNTILSAYNGGLLNVNLSSPPAGEG
LGSSGAATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDN
EMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRR
EYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVT
IVHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGRTA
LRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMT
NLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPA
AWNVPPGVYAVVDLYGQAAQATIVDDVEVAPVPEPLPEGNNQVSPSSPSSGAGGSDLRFH
QLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAG
VTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTA
KGDLHYFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATGPMDNSLATSNTATE
KSFPLHSPVAGVAHRFHSTCGKNVTLEEDGTRAVRAAGYAHGLVFSTKELRAEEVFEVKV
EELDEKWAGSLRLGLTTLAPGEMGPGAGGGGPGLPPSLPELRTKTTWMVSSCEVRRDGQL
QRMNYGRNLERLGVGSRVGVRRGADDTMHILVDGEDMGPAATGIAKNVWAVLDLYGPVRG
VSIVSSTRLEESEGTQPPSPSSDTGSEGEEDDEGEEHGLGGQNEVGIIPTTLEFLENHGK
NILLSNGNRTATRVASYNQGIVVINQPLVPQLLVQVRIDFLNRQWTSSLVLGVITCAPER
LNFPASACALKRAAWLLRGRGVFHNGLKICEKFGPNLDTCPEGTILGLRLDSSGGLHLHV
NGVDQGVAVPDVPQPCHALVDLYGQCEQVTIVNPEPGAASGKSAGTQGDMEKADMVDGIK
ESVCWGPPPAASPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCYCESCRKLRGDEAH
RRRGEPPREYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSNVAAVRRVLDRGELGAG
TASILSCRPLKGEPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGAETLASKVQFRDPK
SQRTHQAQVAFQVCVRPGSYTPGPPSAALGEPPDPHFSPAELEWVTKEKGATLLCALLVR
VE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1L4AAD6	0.162	0.147	0.000	1780	0.385	0.338	A0A1L4AAD6.pdb.gz	A0A1L4AAD6_DROME Neuralized E3 ubiquitin protein ligase 4 OS=Drosophila melanogaster OX=7227 GN=Neurl4 PE=4 SV=1
2	AFDB:Q96JN8	1.000	1.000	0.000	1562	1.000	1.000	Q96JN8.pdb.gz	NEUL4_HUMAN Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4 PE=1 SV=2
3	AFDB:O76050	0.105	0.255	3.740E-22	574	0.064	0.174	O76050.pdb.gz	NEUL1_HUMAN E3 ubiquitin-protein ligase NEURL1 OS=Homo sapiens OX=9606 GN=NEURL1 PE=2 SV=1
4	PDB:7ua3A	0.075	0.031	1.039E-9	4443	0.062	0.022	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
5	PDB:7tzcA	0.078	0.032	1.258E-9	4404	0.070	0.025	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
6	PDB:7u9tA	0.085	0.043	1.320E-9	4229	0.066	0.024	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
7	PDB:3j8hA	0.072	0.041	1.384E-9	3660	0.052	0.022	3j8hA.pdb.gz	Structure of the rabbit ryanodine receptor RyR1 at near-atomic resolution.
8	PDB:7m6aA	0.080	0.032	6.384E-9	4306	0.071	0.026	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
9	PDB:7vmlA	0.069	0.034	9.264E-8	4044	0.052	0.020	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
10	PDB:7ccbA	0.088	0.710	2.296E-7	164	0.022	0.207	7ccbA.pdb.gz
11	PDB:7cf9A	0.087	0.045	6.566E-7	3949	0.060	0.024	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.
12	PDB:5gkyA	0.077	0.045	1.344E-6	3660	0.058	0.025	5gkyA.pdb.gz	The Central domain of RyR1 is the transducer for long-range allosteric gating of channel opening
13	PDB:7nscA	0.097	0.500	3.845E-6	276	0.024	0.134	7nscA.pdb.gz
14	AFDB:A0A2R8Q8D8	0.069	0.079	6.544E-6	1081	0.091	0.131	A0A2R8Q8D8.pdb.gz
15	AFDB:A0A0B4JDC9	0.057	0.052	1.622E-5	1844	0.109	0.093	A0A0B4JDC9.pdb.gz	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
16	AFDB:Q20684	0.070	0.085	2.615E-5	1245	0.044	0.055	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
17	AFDB:A0A1X7SBS1	0.093	0.187	3.483E-5	744	0.031	0.066	A0A1X7SBS1.pdb.gz	A0A1X7SBS1_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
18	AFDB:Q99NH2	0.050	0.053	1.853E-4	1333	0.069	0.080	Q99NH2.pdb.gz	PARD3_MOUSE Partitioning defective 3 homolog OS=Mus musculus OX=10090 GN=Pard3 PE=1 SV=2
19	AFDB:Q8TEW0	0.043	0.047	3.794E-4	1356	0.061	0.071	Q8TEW0.pdb.gz	PARD3_HUMAN Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2
20	AFDB:C4R2D7	0.043	0.060	1.668E-3	839	0.069	0.129	C4R2D7.pdb.gz	FLO11_KOMPG Flocculation protein FLO11 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=FLO11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L4AAD6	0.0	792	1780	0.295	0.259	A0A1L4AAD6_DROME Neuralized E3 ubiquitin protein ligase 4 OS=Drosophila melanogaster OX=7227 GN=Neurl4 PE=4 SV=1
2	Q96JN8	0.0	3199	1562	1.000	1.000	NEUL4_HUMAN Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4 PE=1 SV=2
3	Q9BR09	5.14e-18	88.6	285	0.044	0.239	NEUL2_HUMAN Neuralized-like protein 2 OS=Homo sapiens OX=9606 GN=NEURL2 PE=2 SV=1
4	Q9D0S4	8.00e-17	85.1	285	0.043	0.235	NEUL2_MOUSE Neuralized-like protein 2 OS=Mus musculus OX=10090 GN=Neurl2 PE=1 SV=1
5	P29503	3.75e-10	67.4	754	0.056	0.115	NEUR_DROME Protein neuralized OS=Drosophila melanogaster OX=7227 GN=neur PE=1 SV=2
6	O76050	4.86e-09	63.2	574	0.065	0.176	NEUL1_HUMAN E3 ubiquitin-protein ligase NEURL1 OS=Homo sapiens OX=9606 GN=NEURL1 PE=2 SV=1
7	A8MQ27	4.55e-08	60.1	555	0.060	0.169	NEU1B_HUMAN E3 ubiquitin-protein ligase NEURL1B OS=Homo sapiens OX=9606 GN=NEURL1B PE=1 SV=1
8	Q0MW30	5.71e-08	59.7	546	0.058	0.165	NEU1B_MOUSE E3 ubiquitin-protein ligase NEURL1B OS=Mus musculus OX=10090 GN=Neurl1b PE=1 SV=1
9	A0A096MJM7	1.55e-07	58.5	557	0.065	0.183	A0A096MJM7_RAT Neuralized E3 ubiquitin protein ligase 1 OS=Rattus norvegicus OX=10116 GN=Neurl1 PE=4 SV=2
10	A0A8I5ZN22	1.81e-07	58.2	574	0.065	0.178	A0A8I5ZN22_RAT Neuralized E3 ubiquitin protein ligase 1 OS=Rattus norvegicus OX=10116 GN=Neurl1 PE=4 SV=1
11	Q923S6	2.77e-07	57.8	574	0.060	0.164	NEUL1_MOUSE E3 ubiquitin-protein ligase NEURL1 OS=Mus musculus OX=10090 GN=Neurl1 PE=1 SV=1
12	Q8CJC5	5.11e-04	45.8	254	0.028	0.173	NEUL3_MOUSE E3 ubiquitin-protein ligase NEURL3 OS=Mus musculus OX=10090 GN=Neurl3 PE=2 SV=1
13	D3ZZE6	7.29e-04	45.4	240	0.031	0.200	D3ZZE6_RAT Neuralized E3 ubiquitin protein ligase 1 OS=Rattus norvegicus OX=10116 GN=Neurl1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18914 DUF5666	3.1e+02	13.1	Domain of unknown function (DUF5666)
2	PF01052 FliMN_C	1.1e+02	14.2	Type III flagellar switch regulator (C-ring) FliN C-term
3	PF07177 Neuralized	6e-251	833.0	Neuralized

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261609	0.946	E3 ubiquitin-protein ligase HERC2
2	9606.ENSP00000370803	0.929	Centriolar coiled-coil protein of 110 kDa
3	9606.ENSP00000342510	0.896	Centrosomal protein of 97 kDa
4	9606.ENSP00000232165	0.851	Ubiquitin-protein ligase E3A
5	9606.ENSP00000261845	0.850	Mitogen-activated protein kinase 6
6	9606.ENSP00000417653	0.842	Drebrin-like protein
7	9606.ENSP00000298910	0.832	Leucine-rich repeat serine/threonine-protein kinase 2
8	9606.ENSP00000313811	0.814	Ubiquitin carboxyl-terminal hydrolase 20
9	9606.ENSP00000262127	0.810	Centrosomal protein of 76 kDa
10	9606.ENSP00000269305	0.729	Cellular tumor antigen p53
11	9606.ENSP00000369614	0.715	Centrobin
12	9606.ENSP00000369461	0.677	Enoyl-CoA delta isomerase 2, mitochondrial
13	9606.ENSP00000359829	0.669	Ubiquitin carboxyl-terminal hydrolase 33
14	9606.ENSP00000355500	0.668	Centrosomal protein of 170 kDa
15	9606.ENSP00000261776	0.652	Protein VAC14 homolog
16	9606.ENSP00000302537	0.649	Nuclear protein MDM1
17	9606.ENSP00000362244	0.645	MAP7 domain containing 1
18	9606.ENSP00000301396	0.617	Proline-, glutamic acid- and leucine-rich protein 1
19	9606.ENSP00000448012	0.615	Centrosomal protein of 290 kDa
20	9606.ENSP00000250076	0.608	Zinc finger protein 232

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.950	cellular process
GO:0065007	0.915	biological regulation
GO:0050789	0.897	regulation of biological process
GO:0032502	0.823	developmental process
GO:0050794	0.810	regulation of cellular process
GO:0048731	0.809	system development
GO:0071840	0.515	cellular component organization or biogenesis
GO:0016043	0.459	cellular component organization
GO:0008152	0.432	metabolic process
GO:0071704	0.418	organic substance metabolic process
GO:0044238	0.388	primary metabolic process
GO:0048513	0.366	animal organ development
GO:0006807	0.332	nitrogen compound metabolic process
GO:0050896	0.322	response to stimulus
GO:0043170	0.305	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005813	0.991	centrosome
GO:0005829	0.941	cytosol
GO:0032991	0.888	protein-containing complex
GO:0005634	0.855	nucleus
GO:0070013	0.507	intracellular organelle lumen
GO:0012505	0.339	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]