StarFunc result for job id Q96JP2

User Input

>input (1530 residues)
MKEASGVGGGHSPMCPPHCHMPPGPAGEWPGATVQQPRQRAPTALLQPDAAGPGGGGVSA
GVAVLGACPSASEGVLPRPPGRSAPQPPEYPGRPDMAVPGWSAMVRSRLTATSTSQATDH
TFLQKSHYHHGDHPSYAKPRLPLPVFTVRHYAGTVTYQVHKFLNRNRDQLDPAVVEMLGQ
SQLQLVGSLFQEAEPQSRGGRGRPTLASRFQQALEDLIARLGRSHVYFIQCLTPNPGKLP
GLFDVGHVTEQLHQAAILEAVGTRSANFPVRVPFEAFLASFQALGSEGQEDLSDREKCGA
VLSQVLGAESPLYHLGATKVLLQEQGWQRLEELRDQQRSQALVDLHRSFHTCISRQRVLP
RMQARMRGFQARKRYLRRRAALGQLNTILLVAQPLLQRRQRLQLGRWQGWHSSERALERV
PSMELGRLEIPAELAVMLKTAESHRDALAGSITECLPPEVPARPSLTLPADIDLFPFSSF
VAIGFQEPSLPRPGQPLAKPLTQLDGDNPQRALDINKVMLRLLGDGSLESWQRQIMGAYL
VRQGQCRPGLRNELFSQLVAQLWQNPDEQQSQRGWALMAVLLSAFPPLPVLQKPLLKFVS
DQAPRGMAALCQHKLLGALEQSQLASGATRAHPPTQLEWLAGWRRGRMALDVFTFSEECY
SAEVESWTTGEQLAGWILQSRGLEAPPRGWSVSLHSRDAWQDLAGCDFVLDLISQTEDLG
DPARPRSYPITPLGSAEAIPLAPGIQAPSLPPGPPPGPAPTLPSRDHTGEVQRSGSLDGF
LDQIFQPVISSGLSDLEQSWALSSRMKGGGAIGPTQQGYPMVYPGMIQMPAYQPGMVPAP
MPMMPAMGTVPAMPAMVVPPQPPLPSLDAGQLAVQQQNFIQQQALILAQQMTAQAMSLSL
EQQMQQRQQQARASEAASQASPSAVTSKPRKPPTPPEKPQRDLGSEGGCLRETSEEAEDR
PYQPKSFQQKRNYFQRMGQPQITVRTMKPPAKVHIPQGEAQEEEEEEEEEEEQEEQEVET
RAVPSPPPPPIVKKPLKQGGAKAPKEAEAEPAKETAAKGHGQGPAQGRGTVVRSSDSKPK
RPQPSREIGNIIRMYQSRPGPVPVPVQPSRPPKAFLRKIDPKDEALAKLGINGAHSSPPM
LSPSPGKGPPPAVAPRPKAPLQLGPSSSIKEKQGPLLDLFGQKLPIAHTPPPPPAPPLPL
PEDPGTLSAERRCLTQPVEDQGVSTQLLAPSGSVCFSYTGTPWKLFLRKEVFYPRENFSH
PYYLRLLCEQILRDTFSESCIRISQNERRKMKDLLGGLEVDLDSLTTTEDSVKKRIVVAA
RDNWANYFSRFFPVSGESGSDVQLLAVSHRGLRLLKVTQGPGLRPDQLKILCSYSFAEVL
GVECRGGSTLELSLKSEQLVLHTARARAIEALVELFLNELKKDSGYVIALRSYITDNCSL
LSFHRGDLIKLLPVATLEPGWQFGSAGGRSGLFPADIVQPAAAPDFSFSKEQRSGWHKGQ
LSNGEPGLARWDRASEVRKMGEGQAEARPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:U3JAY7	0.377	0.359	5.067E-77	1612	0.295	0.280	U3JAY7.pdb.gz
2	AFDB:F4IRU3	0.111	0.109	5.303E-13	1556	0.059	0.058	F4IRU3.pdb.gz	MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana OX=3702 GN=XI-F PE=2 SV=1
3	AFDB:F4IVR7	0.128	0.112	6.304E-11	1770	0.053	0.046	F4IVR7.pdb.gz	MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana OX=3702 GN=XI-D PE=3 SV=1
4	PDB:6ycxB	0.140	0.249	9.362E-11	817	0.043	0.081	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
5	PDB:4pa0B	0.104	0.161	4.088E-10	920	0.045	0.075	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
6	AFDB:Q5DU14	0.153	0.124	4.816E-10	1919	0.137	0.109	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
7	PDB:5tbyA	0.138	0.215	1.316E-9	954	0.065	0.104	5tbyA.pdb.gz
8	PDB:4pa0A	0.103	0.153	1.697E-9	974	0.046	0.072	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
9	PDB:4anjA	0.132	0.198	2.080E-9	995	0.037	0.056	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
10	PDB:7mf3B	0.169	0.279	3.638E-9	896	0.055	0.094	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
11	PDB:4p7hB	0.105	0.159	8.080E-8	952	0.046	0.074	4p7hB.pdb.gz
12	PDB:1griA	0.037	0.254	5.606E-4	211	0.020	0.147	1griA.pdb.gz
13	AFDB:O35413	0.038	0.048	8.514E-4	1196	0.074	0.094	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
14	PDB:3qwyA	0.034	0.291	1.805E-3	170	0.016	0.147	3qwyA.pdb.gz
15	AFDB:F1QWN1	0.049	0.064	2.126E-3	1063	0.090	0.130	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
16	PDB:2dybA	0.038	0.184	2.576E-3	298	0.016	0.081	2dybA.pdb.gz
17	AFDB:E7EY47	0.051	0.073	2.741E-3	958	0.082	0.132	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
18	AFDB:F1R419	0.055	0.069	3.534E-3	1060	0.080	0.115	F1R419.pdb.gz	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
19	AFDB:Q7Z2Z1	0.056	0.047	8.386E-3	1910	0.095	0.076	Q7Z2Z1.pdb.gz	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
20	AFDB:Q9VE96	0.045	0.092	1.325E-2	600	0.064	0.163	Q9VE96.pdb.gz	Q9VE96_DROME LD44138p OS=Drosophila melanogaster OX=7227 GN=l(3)05822 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I7HPW8	0.0	1835	3033	0.655	0.330	I7HPW8_MOUSE Myosin XVB OS=Mus musculus OX=10090 GN=Myo15b PE=1 SV=2
2	A0A0G2K1F7	3.69e-141	485	3512	0.203	0.088	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
3	A0A0G2JTE7	7.99e-140	481	3494	0.201	0.088	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
4	Q9QZZ4	9.23e-139	478	3511	0.203	0.089	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2
5	Q9UKN7	1.12e-138	478	3530	0.199	0.086	MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens OX=9606 GN=MYO15A PE=1 SV=2
6	Q9VZ45	4.71e-67	254	3054	0.135	0.067	Q9VZ45_DROME Myosin 10A, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo10A PE=3 SV=3
7	Q0KHU0	6.98e-67	253	3145	0.135	0.066	Q0KHU0_DROME Myosin 10A, isoform D OS=Drosophila melanogaster OX=7227 GN=Myo10A PE=3 SV=2
8	Q20456	7.28e-44	178	2577	0.101	0.060	Q20456_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hum-4 PE=1 SV=6
9	F8VQB6	1.23e-36	154	2062	0.059	0.044	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
10	I3ITL5	2.66e-36	153	2041	0.062	0.047	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
11	Q9HD67	3.06e-36	153	2058	0.065	0.049	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
12	P79114	5.85e-36	152	2052	0.059	0.044	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
13	A0A0A0MQX1	1.49e-34	147	2069	0.067	0.049	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
14	F4IRU3	3.13e-29	130	1556	0.054	0.053	MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana OX=3702 GN=XI-F PE=2 SV=1
15	Q9V3Z6	7.87e-29	129	2167	0.063	0.044	MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=ck PE=1 SV=1
16	B0CN60	1.71e-28	127	1569	0.059	0.058	B0CN60_NICBE Myosin XI-F OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
17	Q9DGG9	2.14e-28	127	2179	0.059	0.041	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
18	Q39160	7.70e-28	125	1520	0.048	0.049	MYO5_ARATH Myosin-5 OS=Arabidopsis thaliana OX=3702 GN=XI-1 PE=1 SV=1
19	F4IUG9	1.09e-27	125	1493	0.062	0.064	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
20	F4JM19	1.39e-27	124	1516	0.061	0.061	MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana OX=3702 GN=XI-H PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00063 Myosin_head	9.7e-30	115.1	Myosin head (motor domain)
2	PF00784 MyTH4	9.1e-16	69.5	MyTH4 domain
3	PF00018 SH3_1	2.2e+02	12.8	SH3 domain
4	PF07653 SH3_2	1.1e-07	42.8	Variant SH3 domain
5	PF14604 SH3_9	0.00069	30.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000009693

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000007510	0.714	Neogenin 1
2	9601.ENSPPYP00000010298	0.714	DCC netrin 1 receptor
3	9601.ENSPPYP00000021890	0.684	Whirlin
4	9601.ENSPPYP00000002560	0.680	Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G- E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha- 4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha- 11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha- 4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, [...]
5	9601.ENSPPYP00000010043	0.680	Belongs to the integrin beta chain family.
6	9601.ENSPPYP00000012844	0.604	Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
7	9601.ENSPPYP00000002826	0.560	Uncharacterized protein
8	9601.ENSPPYP00000005645	0.553	Actin-related protein 2/3 complex subunit 3
9	9601.ENSPPYP00000007447	0.539	Immunoglobulin superfamily, DCC subclass, member 3
10	9601.ENSPPYP00000013782	0.538	ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombinatio [...]
11	9601.ENSPPYP00000019706	0.523	Myosin IG
12	9601.ENSPPYP00000003963	0.522	Uncharacterized protein
13	9601.ENSPPYP00000004701	0.522	Uncharacterized protein
14	9601.ENSPPYP00000008961	0.512	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003774	0.632	cytoskeletal motor activity
GO:0008092	0.443	cytoskeletal protein binding
GO:0044877	0.394	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.909	cellular process
GO:0065007	0.409	biological regulation
GO:0050789	0.399	regulation of biological process
GO:0050794	0.300	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.976	membrane-bounded organelle
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0071944	0.944	cell periphery
GO:0005634	0.919	nucleus
GO:0016020	0.906	membrane
GO:0005886	0.902	plasma membrane
GO:0005829	0.788	cytosol
GO:0043232	0.689	intracellular non-membrane-bounded organelle
GO:0031974	0.573	membrane-enclosed lumen
GO:0043233	0.547	organelle lumen
GO:0070013	0.483	intracellular organelle lumen
GO:0005654	0.364	nucleoplasm
GO:0032991	0.337	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]