StarFunc result for job id Q96JP5

User Input

>input (570 residues)
MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAA
AAAAAAAVSRRRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVT
TDKDPKEEKEEEDDSALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQL
ICKSEPNTDQLDYDVGEEHQSPGGISSEEEEEEEEEMLISEEEIPFKDDPRDETYKPHLE
RETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEEPPRKRGRRRKDDKSPRLP
KRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLL
RHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMK
KHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNP
ESLTQPSDGQGLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGS
SGGTEGLVMNSDILGATTEVLIEDSDSAGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4Z1	0.307	0.307	8.978E-76	570	1.000	1.000	A0A024R4Z1.pdb.gz
2	AFDB:R9PY21	0.153	0.126	8.397E-12	720	0.182	0.144	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
3	AFDB:A0MWD2	0.149	0.164	1.709E-11	510	0.170	0.190	A0MWD2.pdb.gz	A0MWD2_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=zenk PE=2 SV=1
4	AFDB:P26632	0.139	0.153	9.177E-11	511	0.158	0.176	P26632.pdb.gz	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
5	AFDB:Q9VI93	0.104	0.069	2.581E-10	946	0.163	0.098	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
6	AFDB:A0A2R8QUZ1	0.103	0.082	3.804E-10	809	0.182	0.129	A0A2R8QUZ1.pdb.gz
7	AFDB:Q5BIH1	0.170	0.126	4.329E-10	803	0.161	0.115	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
8	AFDB:Q7K9G4	0.159	0.118	1.070E-9	806	0.163	0.115	Q7K9G4.pdb.gz	Q7K9G4_DROME Zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=lmd PE=2 SV=1
9	AFDB:Q8K1M4	0.178	0.135	1.577E-9	789	0.202	0.146	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
10	AFDB:Q4WT96	0.167	0.167	2.178E-9	570	0.160	0.160	Q4WT96.pdb.gz	Q4WT96_ASPFU C2H2 transcription factor, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G10080 PE=4 SV=1
11	PDB:3w5kB	0.094	0.316	6.151E-3	110	0.042	0.218	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.061	0.243	4.673E-1	96	0.030	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:5n5yI	0.038	0.122	1.083	99	0.037	0.212	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
14	PDB:6ydhA	0.034	0.167	1.596	62	0.014	0.129	6ydhA.pdb.gz
15	PDB:4n78F	0.062	0.136	3.045	156	0.028	0.103	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
16	PDB:6fyxm	0.048	0.110	3.466	147	0.054	0.211	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
17	PDB:6o9lQ	0.050	0.062	3.944	430	0.081	0.107	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:5l4kQ	0.054	0.059	4.488	422	0.021	0.028	5l4kQ.pdb.gz
19	PDB:3jckD	0.073	0.093	4.788	384	0.026	0.039	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
20	PDB:5c8dE	0.043	0.074	4.788	280	0.018	0.036	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96JP5	0.0	1164	570	1.000	1.000	ZFP91_HUMAN E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1
2	Q9BU19	1.04e-60	211	519	0.161	0.177	ZN692_HUMAN Zinc finger protein 692 OS=Homo sapiens OX=9606 GN=ZNF692 PE=1 SV=1
3	Q96CK0	2.84e-45	171	615	0.132	0.122	ZN653_HUMAN Zinc finger protein 653 OS=Homo sapiens OX=9606 GN=ZNF653 PE=1 SV=1
4	Q8N554	7.64e-36	144	614	0.116	0.107	ZN276_HUMAN Zinc finger protein 276 OS=Homo sapiens OX=9606 GN=ZNF276 PE=1 SV=4
5	Q86VK4	2.55e-21	99.4	478	0.096	0.115	ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens OX=9606 GN=ZNF410 PE=1 SV=2
6	Q07120	3.25e-19	92.4	423	0.091	0.123	GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus OX=10116 GN=Gfi1 PE=1 SV=1
7	P70338	5.17e-19	92.0	423	0.091	0.123	GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus OX=10090 GN=Gfi1 PE=1 SV=2
8	Q99684	5.82e-19	91.7	422	0.091	0.123	GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 GN=GFI1 PE=1 SV=2
9	Q9H5H4	9.33e-19	92.0	540	0.086	0.091	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
10	Q96GC6	1.11e-18	92.0	653	0.095	0.083	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
11	Q8N184	1.27e-18	92.0	647	0.089	0.079	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
12	G5EDE1	1.64e-18	89.4	336	0.086	0.146	GFI1H_CAEEL Zinc finger protein GFI1 homolog pag-3 OS=Caenorhabditis elegans OX=6239 GN=pag-3 PE=1 SV=1
13	Q8BGV5	2.33e-18	90.9	572	0.086	0.086	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
14	Q8WTR7	2.74e-18	91.3	871	0.104	0.068	ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
15	Q8N988	2.90e-18	89.7	423	0.086	0.116	ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2
16	F8WEC7	3.47e-18	90.9	859	0.104	0.069	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
17	P17098	4.04e-18	90.1	575	0.086	0.085	ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2
18	Q3USU9	1.26e-17	88.6	632	0.082	0.074	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
19	Q6PCX8	1.26e-17	88.6	632	0.082	0.074	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
20	P10075	1.51e-17	87.0	376	0.077	0.117	GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens OX=9606 GN=GLI4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	7.3e-12	56.2	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	0.00042	31.9	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	29	16.1	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	5.8	18.6	Zinc-finger double-stranded RNA-binding
5	PF13913 zf-C2HC_2	2.1e+02	13.2	zinc-finger of a C2HC-type
6	PF13465 zf-H2C2_2	8.8e-08	43.4	Zinc-finger double domain
7	PF17032 zinc_ribbon_15	1.4e+02	14.6	zinc-ribbon family
8	PF09723 Zn-ribbon_8	57	15.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231948	0.868	Protein cereblon
2	9606.ENSP00000368887	0.784	P21-activated protein kinase-interacting protein 1
3	9606.ENSP00000432016	0.739	ANKHD1-EIF4EBP3 readthrough
4	9606.ENSP00000368761	0.736	Zinc finger protein 827
5	9606.ENSP00000326095	0.705	E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates . In turn, participates in different biological processes including interferon production or autophagy . Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6 . Plays also a role in the early recruitment of autophagy adapters to bacteria . Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication
6	9606.ENSP00000330432	0.686	Protein FAM83F
7	9606.ENSP00000262506	0.673	Casein kinase II subunit alpha
8	9606.ENSP00000347416	0.660	AP-3 complex subunit delta-1
9	9606.ENSP00000442699	0.654	HIV Tat-specific factor 1
10	9606.ENSP00000357928	0.649	Pre-mRNA-processing factor 17
11	9606.ENSP00000398131	0.644	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
12	9606.ENSP00000354085	0.643	Ankyrin repeat and KH domain-containing protein 1
13	9606.ENSP00000263381	0.630	Protein Wiz
14	9606.ENSP00000377250	0.611	Protein MON2 homolog
15	9606.ENSP00000407107	0.595	HERV-H LTR-associating 1
16	9606.ENSP00000377895	0.572	F-box only protein 38
17	9606.ENSP00000418915	0.572	Cyclin-dependent kinase inhibitor 2A
18	9606.ENSP00000359935	0.544	Fucose-1-phosphate guanylyltransferase
19	9606.ENSP00000328551	0.536	Ras-related protein Rab-28
20	9606.ENSP00000476369	0.536	F-box/WD repeat-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.962	heterocyclic compound binding
GO:0097159	0.962	organic cyclic compound binding
GO:0003676	0.947	nucleic acid binding
GO:0003824	0.840	catalytic activity
GO:0019787	0.810	ubiquitin-like protein transferase activity
GO:0003677	0.805	DNA binding
GO:0004842	0.697	ubiquitin-protein transferase activity
GO:0043565	0.576	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0080090	0.997	regulation of primary metabolic process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0009987	0.972	cellular process
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.965	primary metabolic process
GO:0006807	0.955	nitrogen compound metabolic process
GO:0043170	0.919	macromolecule metabolic process
GO:0048518	0.881	positive regulation of biological process
GO:1901564	0.771	organonitrogen compound metabolic process
GO:0043412	0.759	macromolecule modification
GO:0036211	0.754	protein modification process
GO:0048522	0.742	positive regulation of cellular process
GO:0051246	0.729	regulation of protein metabolic process
GO:0009893	0.724	positive regulation of metabolic process
GO:0051173	0.703	positive regulation of nitrogen compound metabolic process
GO:0010468	0.682	regulation of gene expression
GO:0010604	0.682	positive regulation of macromolecule metabolic process
GO:0065009	0.630	regulation of molecular function
GO:0019219	0.621	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.620	regulation of cellular biosynthetic process
GO:0010556	0.618	regulation of macromolecule biosynthetic process
GO:0031325	0.592	positive regulation of cellular metabolic process
GO:0051338	0.577	regulation of transferase activity
GO:0031399	0.544	regulation of protein modification process
GO:0051174	0.539	regulation of phosphorus metabolic process
GO:0051252	0.539	regulation of RNA metabolic process
GO:0050896	0.536	response to stimulus
GO:0006355	0.490	regulation of DNA-templated transcription
GO:0048519	0.433	negative regulation of biological process
GO:0044237	0.364	cellular metabolic process
GO:0048523	0.364	negative regulation of cellular process
GO:0010605	0.364	negative regulation of macromolecule metabolic process
GO:0070647	0.321	protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0005730	0.983	nucleolus
GO:0005737	0.585	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.810	Transferases.

[back to server]