StarFunc result for job id Q96JQ0

User Input

>input (1400 residues)
MQKELGIVPSCPGMKSPRPHLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTL
IGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAV
TPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY
ALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQAL
LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSE
GDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQP
SMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSV
IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPE
PLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL
EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQV
TATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAV
DGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRL
SYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI
VPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLD
AVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDT
VLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSG
GPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVL
QVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA
ELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRL
TYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVA
VLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPG
SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP
PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFA
LDAASGRLYLARPLDFEAGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VVG0	0.173	0.139	8.850E-83	1820	0.281	0.216	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
2	AFDB:A0A0R4IZF0	0.138	0.104	1.453E-75	1907	0.234	0.171	A0A0R4IZF0.pdb.gz
3	AFDB:Q99PJ1	0.134	0.098	3.594E-75	1943	0.223	0.161	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
4	AFDB:Q9VFH5	0.145	0.111	4.117E-75	1981	0.254	0.180	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
5	AFDB:Q5ICW6	0.148	0.119	1.277E-74	1796	0.223	0.174	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
6	AFDB:Q9VAF5	0.151	0.128	5.227E-73	1706	0.218	0.179	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
7	AFDB:Q0ZM14	0.145	0.112	9.975E-71	1899	0.220	0.162	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
8	AFDB:Q96QU1	0.132	0.099	7.356E-69	1955	0.235	0.168	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
9	AFDB:F1LXN4	0.149	0.136	1.042E-63	1551	0.204	0.184	F1LXN4.pdb.gz	F1LXN4_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=4
10	AFDB:G5EDK5	0.173	0.105	2.054E-63	2596	0.191	0.103	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
11	PDB:7sqcO0	0.109	0.126	1.519E-17	1140	0.089	0.109	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.128	0.769	1.488E-13	209	0.044	0.297	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:4aq1A	0.084	0.137	2.935E-13	721	0.065	0.126	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.071	0.127	2.714E-11	692	0.066	0.133	5oj2B.pdb.gz
15	PDB:1e07A	0.097	0.159	6.415E-11	642	0.058	0.126	1e07A.pdb.gz
16	PDB:5a42A	0.076	0.070	8.417E-11	1597	0.099	0.086	5a42A.pdb.gz
17	PDB:7q5zA	0.091	0.092	2.857E-10	1344	0.080	0.083	7q5zA.pdb.gz
18	PDB:7nycA	0.069	0.065	1.747E-9	1542	0.081	0.073	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7q1yA	0.081	0.082	2.399E-9	1374	0.086	0.087	7q1yA.pdb.gz
20	PDB:7vonA	0.080	0.080	3.293E-9	1399	0.074	0.074	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YW72	0.0	822	3346	0.383	0.160	A0A0A6YW72_MOUSE Dachsous cadherin related 2 OS=Mus musculus OX=10090 GN=Dchs2 PE=4 SV=1
2	E9PVD3	0.0	2542	3291	0.924	0.393	PCD16_MOUSE Protocadherin-16 OS=Mus musculus OX=10090 GN=Dchs1 PE=1 SV=1
3	Q24292	0.0	895	3503	0.389	0.156	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
4	Q2PZL6	0.0	614	4981	0.343	0.096	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
5	Q6V0I7	0.0	630	4981	0.346	0.097	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
6	Q96JQ0	0.0	2774	3298	1.000	0.424	PCD16_HUMAN Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 PE=1 SV=1
7	X2J8E9	0.0	895	3556	0.389	0.153	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
8	P33450	6.12e-166	556	5147	0.321	0.087	FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3
9	Q6QQE1	2.58e-128	443	3366	0.306	0.127	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
10	Q9NYQ8	3.60e-126	437	4349	0.279	0.090	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
11	Q14517	9.32e-125	433	4588	0.280	0.085	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
12	Q9WU10	5.84e-123	427	4589	0.286	0.087	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
13	P58365	4.84e-122	424	3317	0.304	0.128	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
14	A0A087WRT4	1.48e-121	423	4602	0.278	0.085	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
15	F2Z4A3	1.52e-121	423	4590	0.278	0.085	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
16	A0A1L1SQU7	2.19e-121	422	4645	0.278	0.084	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
17	Q9QXA3	2.34e-121	422	4587	0.278	0.085	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
18	Q8BNA6	2.76e-121	422	4555	0.283	0.087	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
19	Q9H251	7.46e-121	421	3354	0.301	0.126	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2
20	A2BGT8	8.62e-121	421	4611	0.257	0.078	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	2.2e-211	696.4	Cadherin domain
2	PF08266 Cadherin_2	2e-09	48.5	Cadherin-like
3	PF16184 Cadherin_3	0.56	21.5	Cadherin-like
4	PF17803 Cadherin_4	7.1e+02	12.3	Bacterial cadherin-like domain
5	PF08758 Cadherin_pro	14	17.3	Cadherin prodomain like
6	PF03413 PepSY	4.6	19.2	Peptidase propeptide and YPEB domain
7	PF00801 PKD	4.7e+02	12.0	PKD domain
8	PF17756 RET_CLD1	0.0022	29.7	RET Cadherin like domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400223	0.948	Four-jointed box protein 1
2	9606.ENSP00000363068	0.749	Protocadherin-15
3	9606.ENSP00000344456	0.716	Catenin beta-1
4	9606.ENSP00000262717	0.691	Cadherin-20
5	9606.ENSP00000304669	0.682	Catenin alpha-1
6	9606.ENSP00000381058	0.674	Cadherin-7
7	9606.ENSP00000268603	0.666	Cadherin-11
8	9606.ENSP00000357040	0.663	Vang-like protein 2
9	9606.ENSP00000222990	0.662	Sorting nexin-8
10	9606.ENSP00000382004	0.662	Catenin delta-1
11	9606.ENSP00000344115	0.654	Cadherin-5
12	9606.ENSP00000371689	0.651	Cadherin-12
13	9606.ENSP00000027335	0.636	Cadherin-17
14	9606.ENSP00000269141	0.632	Cadherin-2
15	9606.ENSP00000380517	0.620	Cadherin-24
16	9606.ENSP00000381768	0.617	Cadherin-23
17	9606.ENSP00000425093	0.616	Cadherin-18
18	9606.ENSP00000462701	0.613	Cadherin-8
19	9606.ENSP00000268613	0.611	Cadherin-13
20	9606.ENSP00000484928	0.610	Cadherin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.958	ion binding
GO:0043169	0.948	cation binding
GO:0046872	0.942	metal ion binding
GO:0005509	0.782	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.970	multicellular organismal process
GO:0048513	0.964	animal organ development
GO:0007275	0.964	multicellular organism development
GO:0048731	0.941	system development
GO:0009987	0.903	cellular process
GO:0003170	0.821	heart valve development
GO:0035295	0.750	tube development
GO:0003171	0.744	atrioventricular valve development
GO:0003179	0.709	heart valve morphogenesis
GO:0009888	0.679	tissue development
GO:0048729	0.665	tissue morphogenesis
GO:0072006	0.600	nephron development
GO:0002009	0.596	morphogenesis of an epithelium
GO:0003181	0.586	atrioventricular valve morphogenesis
GO:0003007	0.578	heart morphogenesis
GO:0060485	0.503	mesenchyme development
GO:0065007	0.386	biological regulation
GO:0050789	0.378	regulation of biological process
GO:0050794	0.373	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.959	membrane
GO:0005886	0.728	plasma membrane
GO:0043226	0.693	organelle
GO:0043227	0.553	membrane-bounded organelle
GO:0005622	0.492	intracellular anatomical structure
GO:0045177	0.380	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]