StarFunc result for job id Q96JQ2

User Input

>input (1002 residues)
MAAHEWDWFQREELIGQISDIRVQNLQVERENVQKRTFTRWINLHLEKCNPPLEVKDLFV
DIQDGKILMALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIA
DGNPSLVLGLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVA
ISVKDQRKAIKALLAWVQRKTRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALE
NSTRENLEKAFSIAQDALHIPRLLEPEDIMVDTPDEQSIMTYVAQFLERFPELEAEDIFD
SDKEVPIESTFVRIKETPSEQESKVFVLTENGERTYTVNHETSHPPPSKVFVCDKPESMK
EFRLDGVSSHALSDSSTEFMHQIIDQVLQGGPGKTSDISEPSPESSILSSRKENGRSNSL
PIKKTVHFEADTYKDPFCSKNLSLCFEGSPRVAKESLRQDGHVLAVEVAEEKEQKQESSK
IPESSSDKVAGDIFLVEGTNNNSQSSSCNGALESTARHDEESHSLSPPGENTVMADSFQI
KVNLMTVEALEEGDYFEAIPLKASKFNSDLIDFASTSQAFNKVPSPHETKPDEDAEAFEN
HAEKLGKRSIKSAHKKKDSPEPQVKMDKHEPHQDSGEEAEGCPSAPEETPVDKKPEVHEK
AKRKSTRPHYEEEGEDDDLQGVGEELSSSPPSSCVSLETLGSHSEEGLDFKPSPPLSKVS
VIPHDLFYFPHYEVPLAAVLEAYVEDPEDLKNEEMDLEEPEGYMPDLDSREEEADGSQSS
SSSSVPGESLPSASDQVLYLSRGGVGTTPASEPAPLAPHEDHQQRETKENDPMDSHQSQE
SPNLENIANPLEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
PSRTSHSDSSIYLRRHTHRSSESDHFSYVQLRNAADLDDRRNRILTRKANSSGEAMSLGS
HSPQSDSLTQLVQQPDMMYFILFLWLLVYCLLLFPQLDVSRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C5W0	0.439	0.420	7.909E-78	1052	0.720	0.685	Q8C5W0.pdb.gz	CLMN_MOUSE Calmin OS=Mus musculus OX=10090 GN=Clmn PE=1 SV=2
2	PDB:4d1eA	0.199	0.231	6.904E-12	859	0.089	0.104	4d1eA.pdb.gz
3	PDB:1sjjA	0.106	0.122	3.164E-8	863	0.093	0.108	1sjjA.pdb.gz
4	PDB:7sx8D	0.172	0.350	2.473E-6	448	0.054	0.121	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
5	AFDB:F1LR12	0.108	0.049	8.631E-6	2425	0.147	0.061	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
6	AFDB:Q5T5Y3	0.182	0.126	1.146E-4	1602	0.137	0.086	Q5T5Y3.pdb.gz	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
7	AFDB:Q8IVL0	0.115	0.050	1.942E-4	2385	0.138	0.058	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
8	AFDB:Q8IVL1	0.114	0.053	3.619E-4	2488	0.146	0.059	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
9	AFDB:E9Q842	0.113	0.049	5.309E-4	2432	0.159	0.065	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
10	AFDB:Q7YSI9	0.098	0.060	1.319E-3	1654	0.172	0.104	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
11	AFDB:D3Z8E6	0.152	0.099	1.452E-3	1604	0.144	0.090	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
12	AFDB:Q9VIQ9	0.111	0.054	1.523E-3	2197	0.164	0.075	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
13	AFDB:Q80TN7	0.116	0.053	2.579E-3	2359	0.138	0.058	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
14	PDB:2r8uB	0.093	0.603	2.317E-1	136	0.016	0.118	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
15	PDB:7qe7N	0.058	0.079	3.741E-1	682	0.045	0.066	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:3ts7B	0.064	0.132	4.319E-1	297	0.034	0.114	3ts7B.pdb.gz
17	PDB:6wpwR	0.079	0.149	5.757E-1	398	0.030	0.075	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
18	PDB:3k9vA	0.057	0.091	8.860E-1	464	0.029	0.062	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
19	PDB:7sj9M	0.090	0.605	1.126	131	0.016	0.122	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
20	PDB:7kpvC	0.059	0.096	1.181	487	0.037	0.076	7kpvC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C5W0	0.0	1278	1052	0.720	0.685	CLMN_MOUSE Calmin OS=Mus musculus OX=10090 GN=Clmn PE=1 SV=2
2	A0A8I6ABC0	4.01e-76	277	8788	0.166	0.019	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
3	A0A5P8DHN0	4.05e-76	277	8815	0.166	0.019	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
4	A0A8I5ZJB9	4.12e-76	277	8815	0.166	0.019	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
5	A0A5P8DHK4	4.35e-76	277	8697	0.166	0.019	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
6	Q6ZWR6	2.20e-73	269	8799	0.147	0.017	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2
7	Q8NF91	7.15e-73	267	8797	0.145	0.016	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
8	A0A0C4DG40	1.26e-70	260	8749	0.146	0.017	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
9	G3V5X4	1.77e-61	232	6818	0.128	0.019	G3V5X4_HUMAN Spectrin repeat containing nuclear envelope protein 2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1
10	Q8WXH0	1.82e-61	232	6885	0.128	0.019	SYNE2_HUMAN Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3
11	Q6ZWQ0	4.37e-61	231	6874	0.128	0.019	SYNE2_MOUSE Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2
12	Q8I6B6	7.34e-60	207	256	0.123	0.480	Q8I6B6_DROME MSP-300 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=2 SV=1
13	M9MRD6	3.40e-57	219	11999	0.126	0.011	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	M9MRF5	3.40e-57	219	11986	0.126	0.011	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	M9PCM8	3.52e-57	219	11917	0.126	0.011	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
16	M9MRD1	2.14e-56	216	12345	0.123	0.010	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
17	M9PC84	2.24e-56	216	12308	0.124	0.010	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
18	M9MRD4	3.11e-56	216	8382	0.123	0.015	M9MRD4_DROME Muscle-specific protein 300 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
19	M9PC23	1.29e-54	211	7962	0.128	0.016	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
20	O77291	2.84e-48	190	2396	0.107	0.045	O77291_DROME Kakapo (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.0037	28.3	CAMSAP CH domain
2	PF00307 CH	6.3e-40	147.1	Calponin homology (CH) domain
3	PF06294 CH_2	4e+02	12.5	CH-like domain in sperm protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298912

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000399136	0.675	Sodium- and chloride-dependent betaine transporter
2	9606.ENSP00000350719	0.669	Nesprin-2
3	9606.ENSP00000356224	0.661	Nesprin-1
4	9606.ENSP00000362304	0.634	A disintegrin and metalloproteinase with thrombospondin motifs 14
5	9606.ENSP00000458715	0.627	Caspase recruitment domain-containing protein 14
6	9606.ENSP00000298738	0.622	Glutamate-rich protein 6B
7	9606.ENSP00000364150	0.609	Polypeptide N-acetylgalactosaminyltransferase 12
8	9606.ENSP00000262146	0.586	Mitochondrial fission regulator 1
9	9606.ENSP00000287152	0.584	Kinesin-like protein KIF6
10	9606.ENSP00000381007	0.568	Neuron navigator 3
11	9606.ENSP00000297325	0.564	SUN domain-containing protein 3
12	9606.ENSP00000348496	0.564	SUN domain-containing protein 5
13	9606.ENSP00000363391	0.564	Sperm-associated antigen 4 protein
14	9606.ENSP00000384015	0.564	SUN domain-containing protein 1
15	9606.ENSP00000385616	0.564	SUN domain-containing protein 2
16	9606.ENSP00000384286	0.557	Uncharacterized protein C17orf51
17	9606.ENSP00000346414	0.549	Leucine rich repeats and IQ motif containing 3
18	9606.ENSP00000334308	0.540	Nesprin-3
19	9606.ENSP00000404220	0.540	Protein KASH5
20	9606.ENSP00000296328	0.537	UBX domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.993	cytoskeletal protein binding
GO:0003779	0.383	actin binding
GO:0044877	0.320	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0048856	0.967	anatomical structure development
GO:0016043	0.956	cellular component organization
GO:0065007	0.948	biological regulation
GO:0050789	0.906	regulation of biological process
GO:0050794	0.829	regulation of cellular process
GO:0032501	0.575	multicellular organismal process
GO:0048519	0.536	negative regulation of biological process
GO:0048523	0.529	negative regulation of cellular process
GO:0007275	0.403	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.972	intracellular organelle
GO:0016020	0.929	membrane
GO:0043231	0.926	intracellular membrane-bounded organelle
GO:0012505	0.509	endomembrane system
GO:0043232	0.439	intracellular non-membrane-bounded organelle
GO:0071944	0.342	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]