StarFunc result for job id Q96JY0

User Input

>input (434 residues)
MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMARE
WRAAQGKDPGPSEKQKPVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASEIRQDL
QLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFN
SSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY
MSQKDGYKSFSSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BVN9	0.715	0.715	2.326E-70	434	0.899	0.899	Q8BVN9.pdb.gz	MAEL_MOUSE Protein maelstrom homolog OS=Mus musculus OX=10090 GN=Mael PE=1 SV=1
2	AFDB:Q9VNS0	0.481	0.457	3.790E-17	459	0.166	0.157	Q9VNS0.pdb.gz	MAEL_DROME Protein maelstrom OS=Drosophila melanogaster OX=7227 GN=mael PE=1 SV=1
3	PDB:3v9xB	0.262	0.471	8.860E-5	212	0.055	0.113	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
4	PDB:3c95A	0.266	0.260	6.304E-4	446	0.048	0.047	3c95A.pdb.gz
5	PDB:6styA	0.223	0.437	6.678E-4	198	0.044	0.096	6styA.pdb.gz	Human REXO2 controls short mitochondrial RNAs generated by mtRNA processing and decay machinery to prevent accumulation of double-stranded RNA.
6	PDB:1zbuB	0.314	0.429	1.260E-3	304	0.065	0.092	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
7	PDB:3u3yB	0.295	0.519	2.519E-3	220	0.067	0.132	3u3yB.pdb.gz	Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
8	PDB:4js4A	0.295	0.277	5.333E-3	468	0.058	0.053	4js4A.pdb.gz	Crystal structures of Escherichia coli exonuclease I in complex with single-stranded DNA provide insights into the mechanism of processive digestion.
9	PDB:2igiA	0.253	0.508	7.540E-3	180	0.055	0.133	2igiA.pdb.gz	Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli
10	PDB:8d0kF	0.202	0.110	1.129E-2	915	0.044	0.021	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
11	PDB:4hecB	0.192	0.451	1.196E-2	163	0.030	0.080	4hecB.pdb.gz	Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
12	PDB:2p51A	0.251	0.390	1.692E-2	255	0.053	0.090	2p51A.pdb.gz	The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
13	AFDB:F1NBU2	0.094	0.068	1.475E-1	730	0.090	0.053	F1NBU2.pdb.gz
14	AFDB:C9JA69	0.124	0.062	1.656E-1	891	0.184	0.090	C9JA69.pdb.gz	C9JA69_HUMAN BBX high mobility group box domain containing OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
15	AFDB:A0A0G2K7K3	0.078	0.055	2.949E-1	720	0.115	0.069	A0A0G2K7K3.pdb.gz	A0A0G2K7K3_RAT SIX homeobox 5 OS=Rattus norvegicus OX=10116 GN=Six5 PE=3 SV=1
16	AFDB:Q8WWM7	0.064	0.031	3.310E-1	1075	0.115	0.047	Q8WWM7.pdb.gz	ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2
17	AFDB:Q9XTL2	0.076	0.057	4.417E-1	689	0.136	0.086	Q9XTL2.pdb.gz	Q9XTL2_DROME Jak pathway signal transduction adaptor molecule OS=Drosophila melanogaster OX=7227 GN=Stam PE=1 SV=1
18	AFDB:Q9FNE4	0.083	0.050	5.252E-1	1008	0.124	0.054	Q9FNE4.pdb.gz	PDP3_ARATH PWWP domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=PDP3 PE=1 SV=1
19	AFDB:Q29ST6	0.069	0.068	7.425E-1	442	0.078	0.077	Q29ST6.pdb.gz	Q29ST6_DANRE Adenosine receptor A2 OS=Danio rerio OX=7955 GN=a2aa PE=2 SV=1
20	AFDB:Q8NFJ5	0.108	0.123	7.425E-1	357	0.065	0.078	Q8NFJ5.pdb.gz	RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens OX=9606 GN=GPRC5A PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BVN9	0.0	818	434	0.899	0.899	MAEL_MOUSE Protein maelstrom homolog OS=Mus musculus OX=10090 GN=Mael PE=1 SV=1
2	Q9VNS0	3.42e-09	60.8	459	0.141	0.133	MAEL_DROME Protein maelstrom OS=Drosophila melanogaster OX=7227 GN=mael PE=1 SV=1
3	Q9M658	0.74	35.0	2001	0.053	0.011	MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana OX=3702 GN=MOM1 PE=1 SV=1
4	Q8VBW5	1.6	33.5	907	0.053	0.025	BBX_MOUSE HMG box transcription factor BBX OS=Mus musculus OX=10090 GN=Bbx PE=1 SV=2
5	Q8WY36	1.7	33.5	941	0.053	0.024	BBX_HUMAN HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
6	C9JA69	1.8	33.5	891	0.053	0.026	C9JA69_HUMAN BBX high mobility group box domain containing OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
7	C9J8D0	2.0	33.1	448	0.071	0.069	C9J8D0_HUMAN BBX high mobility group box domain containing (Fragment) OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1
8	Q8IXL6	8.1	31.2	584	0.048	0.036	FA20C_HUMAN Extracellular serine/threonine protein kinase FAM20C OS=Homo sapiens OX=9606 GN=FAM20C PE=1 SV=2
9	O54879	9.4	30.4	200	0.053	0.115	HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus OX=10090 GN=Hmgb3 PE=1 SV=3
10	P40618	9.7	30.4	202	0.053	0.114	HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus OX=9031 GN=HMGB3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	0.079	24.7	HMG (high mobility group) box
2	PF09011 HMG_box_2	6e-23	92.5	HMG-box domain
3	PF13017 Maelstrom	1.3e-39	147.7	piRNA pathway germ-plasm component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356846

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387303	0.984	ATP-dependent RNA helicase TDRD9
2	9606.ENSP00000252037	0.967	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
3	9606.ENSP00000299001	0.967	Piwi-like protein 4
4	9606.ENSP00000359049	0.963	Small RNA 2'-O-methyltransferase
5	9606.ENSP00000262794	0.950	RNA helicase Mov10l1
6	9606.ENSP00000284629	0.945	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
7	9606.ENSP00000251864	0.938	Tudor domain-containing protein 1
8	9606.ENSP00000349208	0.932	Piwi-like protein 2
9	9606.ENSP00000245255	0.930	Piwi-like protein 1
10	9606.ENSP00000357812	0.926	Tudor and KH domain-containing protein
11	9606.ENSP00000424838	0.925	Probable ATP-dependent RNA helicase DDX4
12	9606.ENSP00000335153	0.902	Heat shock protein HSP 90-alpha
13	9606.ENSP00000390621	0.856	Putative ATP-dependent RNA helicase TDRD12
14	9606.ENSP00000446485	0.818	Gametocyte-specific factor 1
15	9606.ENSP00000317177	0.773	Mitochondrial cardiolipin hydrolase
16	9606.ENSP00000343818	0.772	CDK5 regulatory subunit-associated protein 2
17	9606.ENSP00000406052	0.769	Tudor domain-containing protein 5
18	9606.ENSP00000346065	0.763	Tudor domain-containing protein 6
19	9606.ENSP00000313422	0.703	ADP-ribosylation factor-like protein 6-interacting protein 4
20	9606.ENSP00000255324	0.695	RING finger protein 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.889	nucleic acid binding
GO:0003677	0.636	DNA binding
GO:0043565	0.359	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.987	regulation of biological process
GO:0044260	0.965	cellular macromolecule metabolic process
GO:0050794	0.940	regulation of cellular process
GO:0044238	0.935	primary metabolic process
GO:0010468	0.934	regulation of gene expression
GO:0031326	0.933	regulation of cellular biosynthetic process
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0006139	0.916	nucleobase-containing compound metabolic process
GO:0090304	0.913	nucleic acid metabolic process
GO:0032501	0.889	multicellular organismal process
GO:0016043	0.887	cellular component organization
GO:0080090	0.886	regulation of primary metabolic process
GO:0051171	0.886	regulation of nitrogen compound metabolic process
GO:0048232	0.871	male gamete generation
GO:0006259	0.870	DNA metabolic process
GO:0019219	0.855	regulation of nucleobase-containing compound metabolic process
GO:0032502	0.845	developmental process
GO:0006996	0.836	organelle organization
GO:0050896	0.835	response to stimulus
GO:0051252	0.828	regulation of RNA metabolic process
GO:0048523	0.826	negative regulation of cellular process
GO:0007049	0.825	cell cycle
GO:0016070	0.815	RNA metabolic process
GO:0070918	0.800	regulatory ncRNA processing
GO:0003006	0.788	developmental process involved in reproduction
GO:0048856	0.752	anatomical structure development
GO:0031324	0.752	negative regulation of cellular metabolic process
GO:0051172	0.747	negative regulation of nitrogen compound metabolic process
GO:0030154	0.722	cell differentiation
GO:0022412	0.652	cellular process involved in reproduction in multicellular organism
GO:0051253	0.624	negative regulation of RNA metabolic process
GO:0048468	0.611	cell development
GO:0051321	0.563	meiotic cell cycle
GO:2000241	0.498	regulation of reproductive process
GO:2001141	0.493	regulation of RNA biosynthetic process
GO:0008219	0.487	cell death
GO:0007283	0.454	spermatogenesis
GO:0022402	0.434	cell cycle process
GO:0051716	0.418	cellular response to stimulus
GO:1903506	0.418	regulation of nucleic acid-templated transcription
GO:0006357	0.367	regulation of transcription by RNA polymerase II
GO:0033554	0.360	cellular response to stress
GO:0006974	0.341	cellular response to DNA damage stimulus
GO:0050793	0.335	regulation of developmental process
GO:0007154	0.330	cell communication
GO:0010558	0.329	negative regulation of macromolecule biosynthetic process
GO:0031327	0.328	negative regulation of cellular biosynthetic process
GO:0048285	0.311	organelle fission
GO:0043412	0.303	macromolecule modification
GO:0012501	0.300	programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043186	1.000	P granule
GO:0048471	0.999	perinuclear region of cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0043073	0.997	germ cell nucleus
GO:0001741	0.997	XY body
GO:0033391	0.997	chromatoid body
GO:0000785	0.984	chromatin
GO:0001673	0.983	male germ cell nucleus
GO:0030849	0.725	autosome
GO:0071547	0.725	piP-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]