StarFunc result for job id Q96K12

User Input

>input (515 residues)
MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQIL
DSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDT
LRHAVQLNVTATRQLLLMASQMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDS
LEWLDDAIIDEITPKLIRDWPNIYTYTKALGEMVVQQESRNLNIAIIRPSIVGATWQEPF
PGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDTVVNLMLAVGWYTAVHRPKST
LVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQYWNAVSHRAP
AIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV
FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWR
LLIARSQMARNVWFFIVSFCYKFLSYFRASSTLKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96K12	1.000	1.000	8.112E-99	515	1.000	1.000	Q96K12.pdb.gz	FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens OX=9606 GN=FAR2 PE=1 SV=1
2	AFDB:Q7TNT2	0.995	0.995	5.001E-91	515	0.880	0.880	Q7TNT2.pdb.gz	FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus OX=10090 GN=Far2 PE=1 SV=1
3	AFDB:Q8WVX9	0.970	0.970	3.051E-73	515	0.590	0.590	Q8WVX9.pdb.gz	FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1
4	AFDB:Q9VLJ7	0.898	0.884	1.001E-51	523	0.318	0.314	Q9VLJ7.pdb.gz	Q9VLJ7_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=Sgp PE=2 SV=2
5	AFDB:Q8MS59	0.912	0.909	1.954E-50	517	0.299	0.298	Q8MS59.pdb.gz	WAT_DROME Fatty acyl-CoA reductase wat OS=Drosophila melanogaster OX=7227 GN=wat PE=1 SV=1
6	AFDB:Q960W6	0.912	0.910	2.063E-50	516	0.309	0.308	Q960W6.pdb.gz	FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster OX=7227 GN=CG8306 PE=2 SV=1
7	AFDB:Q0E8W1	0.901	0.929	1.791E-49	499	0.309	0.319	Q0E8W1.pdb.gz	Q0E8W1_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=CG2858 PE=3 SV=1
8	AFDB:Q8MMC6	0.913	0.929	3.244E-49	506	0.313	0.318	Q8MMC6.pdb.gz	Q8MMC6_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=CG18680 PE=2 SV=1
9	AFDB:Q9W0Y5	0.908	0.936	1.768E-47	499	0.295	0.305	Q9W0Y5.pdb.gz	Q9W0Y5_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30427 PE=2 SV=2
10	AFDB:Q9W508	0.880	0.898	2.567E-42	504	0.276	0.282	Q9W508.pdb.gz	Q9W508_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=FarO PE=2 SV=3
11	PDB:4r1sA	0.433	0.663	2.573E-12	319	0.120	0.194	4r1sA.pdb.gz	Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
12	PDB:4r1uB	0.412	0.648	5.481E-12	309	0.113	0.188	4r1uB.pdb.gz
13	PDB:6lttA	0.444	0.697	8.001E-12	311	0.120	0.199	6lttA.pdb.gz
14	PDB:1y1pA	0.399	0.573	1.301E-11	342	0.109	0.164	1y1pA.pdb.gz	X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
15	PDB:6el3A	0.472	0.637	3.833E-11	364	0.109	0.154	6el3A.pdb.gz	PRISEs (progesterone 5 beta-reductase and/or iridoid synthase-like 1,4-enone reductases): Catalytic and substrate promiscuity allows for realization of multiple pathways in plant metabolism.
16	PDB:5in4A	0.461	0.638	4.046E-11	355	0.103	0.149	5in4A.pdb.gz	Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
17	PDB:1bxkB	0.470	0.677	4.271E-11	344	0.117	0.174	1bxkB.pdb.gz	Molecular Structure of Dtdp-Glucose 4,6-Dehydratase from E. Coli
18	PDB:1z7eD	0.503	0.410	6.234E-11	644	0.124	0.099	1z7eD.pdb.gz	Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance
19	PDB:1i3kA	0.494	0.701	8.167E-11	347	0.099	0.147	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
20	PDB:2pk3A	0.446	0.703	1.129E-10	309	0.103	0.172	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TNT2	0.0	957	515	0.880	0.880	FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus OX=10090 GN=Far2 PE=1 SV=1
2	Q8WVX9	0.0	677	515	0.590	0.590	FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1
3	Q922J9	0.0	675	515	0.590	0.590	FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus OX=10090 GN=Far1 PE=1 SV=1
4	Q96K12	0.0	1074	515	1.000	1.000	FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens OX=9606 GN=FAR2 PE=1 SV=1
5	E9PNW8	6.55e-145	421	335	0.371	0.570	E9PNW8_HUMAN Fatty acyl-CoA reductase (Fragment) OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1
6	Q960W6	1.07e-99	311	516	0.309	0.308	FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster OX=7227 GN=CG8306 PE=2 SV=1
7	Q8MS59	1.42e-98	309	517	0.293	0.292	WAT_DROME Fatty acyl-CoA reductase wat OS=Drosophila melanogaster OX=7227 GN=wat PE=1 SV=1
8	Q8MMC6	2.99e-97	305	506	0.295	0.300	Q8MMC6_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=CG18680 PE=2 SV=1
9	Q0E8W1	4.77e-95	299	499	0.303	0.313	Q0E8W1_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=CG2858 PE=3 SV=1
10	Q9W0Y5	2.58e-92	292	499	0.307	0.317	Q9W0Y5_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30427 PE=2 SV=2
11	Q9VLJ7	2.91e-92	293	523	0.324	0.319	Q9VLJ7_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=Sgp PE=2 SV=2
12	D2SNU9	2.07e-88	280	453	0.311	0.353	D2SNU9_HELVI Fatty acyl-CoA reductase OS=Heliothis virescens OX=7102 GN=hvpg0105 PE=2 SV=1
13	Q5BI89	1.11e-70	233	421	0.252	0.309	Q5BI89_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=CG30427 PE=2 SV=1
14	Q54I12	1.55e-70	246	1279	0.270	0.109	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
15	I7LW01	2.64e-60	217	1140	0.266	0.120	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
16	Q9W508	1.10e-56	199	504	0.276	0.282	Q9W508_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=FarO PE=2 SV=3
17	Q57TU9	4.96e-55	196	604	0.202	0.172	Q57TU9_TRYB2 Fatty acyl-CoA reductase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.500 PE=3 SV=1
18	Q8S7T9	2.54e-54	194	608	0.270	0.229	Q8S7T9_ORYSJ Fatty acyl-CoA reductase OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g07140 PE=1 SV=1
19	O46038	8.82e-52	185	475	0.270	0.293	O46038_DROME Fatty acyl-CoA reductase OS=Drosophila melanogaster OX=7227 GN=FarO PE=3 SV=1
20	B9TSP7	2.17e-48	177	548	0.270	0.254	FACR6_ARATH Fatty acyl-CoA reductase 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAR6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	0.044	24.4	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF19218 CoV_NSP3_C	1.6e+02	12.7	Coronavirus replicase NSP3, C-terminal
3	PF01370 Epimerase	0.0035	28.4	NAD dependent epimerase/dehydratase family
4	PF16363 GDP_Man_Dehyd	10	17.1	GDP-mannose 4,6 dehydratase
5	PF08659 KR	6.1e+02	11.7	KR domain
6	PF07993 NAD_binding_4	1.7e-71	252.0	Male sterility protein
7	PF02719 Polysacc_synt_2	0.03	25.1	Polysaccharide biosynthesis protein
8	PF04321 RmlD_sub_bind	0.024	25.3	RmlD substrate binding domain
9	PF01118 Semialdhyde_dh	0.84	21.5	Semialdehyde dehydrogenase, NAD binding domain
10	PF03015 Sterile	4.5e-29	111.9	Male sterility protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443291

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264167	0.982	Alkyldihydroxyacetonephosphate synthase, peroxisomal
2	9606.ENSP00000355607	0.868	Glyceronephosphate O-acyltransferase
3	9606.ENSP00000346874	0.807	Fatty acyl-CoA reductase 1
4	9606.ENSP00000315680	0.686	Peroxisomal targeting signal 2 receptor
5	9606.ENSP00000288111	0.642	Dehydrogenase/reductase SDR family member 1
6	9606.ENSP00000307607	0.594	Epidermal retinol dehydrogenase 2
7	9606.ENSP00000357051	0.582	Peroxisomal biogenesis factor 19
8	9606.ENSP00000370648	0.579	Retinol dehydrogenase 14
9	9606.ENSP00000381206	0.540	Retinol dehydrogenase 16
10	9606.ENSP00000385083	0.500	3-ketodihydrosphingosine reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0080019	1.000	fatty-acyl-CoA reductase (alcohol-forming) activity
GO:0005488	0.644	binding
GO:0005515	0.559	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901568	0.988	fatty acid derivative metabolic process
GO:1901576	0.983	organic substance biosynthetic process
GO:0044237	0.982	cellular metabolic process
GO:1901570	0.963	fatty acid derivative biosynthetic process
GO:1901360	0.918	organic cyclic compound metabolic process
GO:0044281	0.904	small molecule metabolic process
GO:0006807	0.779	nitrogen compound metabolic process
GO:0033865	0.655	nucleoside bisphosphate metabolic process
GO:0034032	0.578	purine nucleoside bisphosphate metabolic process
GO:0035383	0.568	thioester metabolic process
GO:0033875	0.463	ribonucleoside bisphosphate metabolic process
GO:0006637	0.450	acyl-CoA metabolic process
GO:0044255	0.373	cellular lipid metabolic process
GO:0044249	0.337	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	1.000	peroxisome
GO:0016020	0.985	membrane
GO:0031090	0.952	organelle membrane
GO:0098588	0.647	bounding membrane of organelle
GO:0005778	0.606	peroxisomal membrane
GO:0012505	0.393	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.-	1.000	With NAD(+) or NADP(+) as acceptor.

[back to server]