StarFunc result for job id Q96K19

User Input

>input (258 residues)
MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELV
RVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSW
LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTL
LRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLL
LIYISIMYREVITQRLTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96K19	1.000	1.000	2.001E-46	258	1.000	1.000	Q96K19.pdb.gz	RN170_HUMAN E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens OX=9606 GN=RNF170 PE=1 SV=2
2	AFDB:Q7SZN2	0.514	0.499	2.203E-27	266	0.640	0.620	Q7SZN2.pdb.gz	RN170_DANRE E3 ubiquitin-protein ligase RNF170 OS=Danio rerio OX=7955 GN=rnf170 PE=2 SV=1
3	AFDB:F4I1E4	0.236	0.295	9.413E-8	203	0.209	0.266	F4I1E4.pdb.gz	F4I1E4_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=At1g22510 PE=1 SV=1
4	AFDB:Q6PCN7	0.213	0.057	1.253E-3	1003	0.120	0.031	Q6PCN7.pdb.gz	HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus OX=10090 GN=Hltf PE=1 SV=1
5	AFDB:P43254	0.199	0.080	1.706E-3	675	0.167	0.064	P43254.pdb.gz	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
6	AFDB:O64824	0.212	0.238	1.815E-3	227	0.097	0.110	O64824.pdb.gz	O64824_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g23780 PE=1 SV=1
7	AFDB:Q14527	0.201	0.054	2.470E-3	1009	0.116	0.030	Q14527.pdb.gz	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2
8	AFDB:Q582V4	0.196	0.170	2.470E-3	298	0.132	0.114	Q582V4.pdb.gz	Q582V4_TRYB2 Peroxisome assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.510 PE=3 SV=1
9	AFDB:P93744	0.210	0.132	2.794E-3	425	0.109	0.066	P93744.pdb.gz	P93744_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE2 PE=1 SV=1
10	AFDB:Q6NLR3	0.201	0.132	2.794E-3	413	0.128	0.080	Q6NLR3.pdb.gz	Q6NLR3_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g44410 PE=1 SV=1
11	PDB:5dkaA	0.164	0.428	6.739E-3	96	0.070	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:5gm6a	0.160	0.319	1.808E-2	123	0.081	0.171	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7qcdC	0.161	0.156	2.130E-1	267	0.054	0.052	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
14	PDB:5a31B	0.174	0.492	2.409E-1	84	0.058	0.179	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
15	PDB:3jb9U	0.179	0.112	4.748E-1	430	0.116	0.070	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:5gmkq	0.175	0.120	6.463E-1	387	0.081	0.054	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
17	PDB:7oikA	0.188	0.014	7.311E-1	4426	0.074	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
18	PDB:7egb0	0.152	0.166	8.797E-1	234	0.101	0.111	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
19	PDB:4fjcE	0.130	0.091	9.356E-1	434	0.081	0.048	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
20	PDB:7dvq9	0.185	0.121	1.126	409	0.039	0.024	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96K19	0.0	531	258	1.000	1.000	RN170_HUMAN E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens OX=9606 GN=RNF170 PE=1 SV=2
2	Q7SZN2	6.59e-114	329	266	0.640	0.620	RN170_DANRE E3 ubiquitin-protein ligase RNF170 OS=Danio rerio OX=7955 GN=rnf170 PE=2 SV=1
3	F4I1E4	1.90e-14	72.0	203	0.213	0.271	F4I1E4_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=At1g22510 PE=1 SV=1
4	Q6MFY8	4.50e-08	54.7	247	0.093	0.097	TRI40_RAT E3 ubiquitin ligase TRIM40 OS=Rattus norvegicus OX=10116 GN=Trim40 PE=3 SV=1
5	Q6P9F5	4.09e-07	52.0	258	0.078	0.078	TRI40_HUMAN E3 ubiquitin ligase TRIM40 OS=Homo sapiens OX=9606 GN=TRIM40 PE=1 SV=3
6	A0A060IVL7	7.54e-07	52.0	548	0.093	0.044	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
7	E7F8P0	7.54e-07	52.0	548	0.093	0.044	E7F8P0_DANRE Tripartite motif-containing 69 OS=Danio rerio OX=7955 GN=rnf36 PE=4 SV=1
8	A0A0R4IUT0	1.86e-06	50.8	544	0.081	0.039	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
9	Q3UWZ0	5.80e-06	49.3	467	0.078	0.043	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
10	Q08CC1	6.45e-06	49.3	573	0.089	0.040	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
11	Q5D7I0	1.33e-05	48.1	494	0.081	0.043	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
12	Q9FNI6	1.49e-05	48.1	1029	0.105	0.026	SM3L2_ARATH DNA repair protein RAD5A OS=Arabidopsis thaliana OX=3702 GN=RAD5A PE=1 SV=1
13	Q1XH17	1.51e-05	48.1	477	0.085	0.046	TRI72_MOUSE Tripartite motif-containing protein 72 OS=Mus musculus OX=10090 GN=Trim72 PE=1 SV=1
14	Q587N6	1.53e-05	48.1	495	0.081	0.042	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
15	O13033	1.80e-05	48.1	1057	0.105	0.026	RAG1_DANRE V(D)J recombination-activating protein 1 OS=Danio rerio OX=7955 GN=rag1 PE=1 SV=1
16	Q9FIY7	1.82e-05	48.1	1277	0.081	0.016	SM3L3_ARATH DNA repair protein RAD5B OS=Arabidopsis thaliana OX=3702 GN=RAD5B PE=3 SV=1
17	Q0PF16	1.84e-05	47.8	497	0.081	0.042	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
18	P19474	2.16e-05	47.4	475	0.093	0.051	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
19	Q9C035	3.05e-05	47.0	493	0.078	0.041	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
20	Q495X7	3.16e-05	47.0	471	0.074	0.040	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	2.7e+02	12.9	Baculovirus immediate-early protein (IE-0)
2	PF01036 Bac_rhodopsin	11	17.0	Bacteriorhodopsin-like protein
3	PF14255 Cys_rich_CPXG	3.4e+02	12.6	Cysteine-rich CPXCG
4	PF06044 DpnI	4.3e+02	11.9	Dam-replacing family
5	PF06803 DUF1232	8.6e-06	36.8	Protein of unknown function (DUF1232)
6	PF14447 Prok-RING_4	0.66	21.2	Prokaryotic RING finger family 4
7	PF12861 zf-ANAPC11	2.4e+02	13.2	Anaphase-promoting complex subunit 11 RING-H2 finger
8	PF00097 zf-C3HC4	1.8e-05	35.8	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	0.1	23.7	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	6.1e-05	34.1	Zinc finger, C3HC4 type (RING finger)
11	PF15227 zf-C3HC4_4	0.00039	31.8	zinc finger of C3HC4-type, RING
12	PF11789 zf-Nse	28	16.0	Zinc-finger of the MIZ type in Nse subunit
13	PF13639 zf-RING_2	0.0078	27.9	Ring finger domain
14	PF14634 zf-RING_5	0.033	25.5	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	3.5e-05	35.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000008078

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000014077	0.754	ER lipid raft associated 1
2	9612.ENSCAFP00000009309	0.739	ER lipid raft associated 2
3	9612.ENSCAFP00000039145	0.688	Small integral membrane protein 19
4	9612.ENSCAFP00000008030	0.656	Farnesyltransferase, CAAX box, alpha
5	9612.ENSCAFP00000008080	0.656	THAP domain containing, apoptosis associated protein 1
6	9612.ENSCAFP00000016971	0.656	Calcium binding protein 4
7	9612.ENSCAFP00000009453	0.654	Ring finger protein 122
8	9612.ENSCAFP00000000678	0.653	TBC1 domain family, member 15
9	9612.ENSCAFP00000008128	0.648	Cholinergic receptor nicotinic alpha 6 subunit
10	9612.ENSCAFP00000008152	0.648	Cholinergic receptor, nicotinic, beta 3 (neuronal)
11	9612.ENSCAFP00000008235	0.648	Canis lupus familiaris voltage-dependent anion channel 3 (VDAC3), transcript variant 2, mRNA
12	9612.ENSCAFP00000008348	0.648	Adaptor-related protein complex 3, mu 2 subunit
13	9612.ENSCAFP00000019445	0.648	BTB (POZ) domain containing 1
14	9612.ENSCAFP00000029420	0.648	Protein phosphatase 1, regulatory subunit 26
15	9612.ENSCAFP00000031333	0.648	Cilia and flagella associated protein 157
16	9612.ENSCAFP00000042574	0.648	Hook microtubule-tethering protein 3
17	9612.ENSCAFP00000022106	0.638	Transmembrane protein 129, E3 ubiquitin protein ligase
18	9612.ENSCAFP00000027335	0.589	Membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase
19	9612.ENSCAFP00000016867	0.583	Phosphatidylinositol transfer protein, membrane-associated 1
20	9612.ENSCAFP00000017035	0.582	Ribosomal protein S6 kinase, 70kDa, polypeptide 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.935	ubiquitin-protein transferase activity
GO:0061659	0.665	ubiquitin-like protein ligase activity
GO:0061630	0.428	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0019538	0.983	protein metabolic process
GO:0009987	0.968	cellular process
GO:0044237	0.952	cellular metabolic process
GO:0032446	0.946	protein modification by small protein conjugation
GO:0050896	0.836	response to stimulus
GO:0065007	0.812	biological regulation
GO:0050789	0.753	regulation of biological process
GO:0009056	0.730	catabolic process
GO:0044260	0.697	cellular macromolecule metabolic process
GO:0016567	0.687	protein ubiquitination
GO:0044248	0.652	cellular catabolic process
GO:0051603	0.615	proteolysis involved in protein catabolic process
GO:0051716	0.566	cellular response to stimulus
GO:0043632	0.565	modification-dependent macromolecule catabolic process
GO:0019941	0.561	modification-dependent protein catabolic process
GO:0006511	0.538	ubiquitin-dependent protein catabolic process
GO:0050794	0.491	regulation of cellular process
GO:0006950	0.480	response to stress
GO:0010498	0.441	proteasomal protein catabolic process
GO:0033554	0.376	cellular response to stress
GO:0043161	0.350	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0042221	0.338	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0032991	0.905	protein-containing complex
GO:1902494	0.368	catalytic complex
GO:0005634	0.332	nucleus
GO:1990234	0.326	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.937	Transferases.

[back to server]