StarFunc result for job id Q96K21

User Input

>input (471 residues)
MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSWGEGPRGPGLG
RRDLSSADPAVLGATMESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNT
QQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAER
LARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPA
HHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWS
LEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDE
ETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPW
CCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96K21	1.000	1.000	8.260E-83	471	1.000	1.000	Q96K21.pdb.gz	ANCHR_HUMAN Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19 PE=1 SV=3
2	AFDB:O95405	0.127	0.043	5.861E-7	1425	0.093	0.031	O95405.pdb.gz	ZFYV9_HUMAN Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 PE=1 SV=2
3	AFDB:Q8IKN0	0.120	0.167	1.543E-6	325	0.104	0.151	Q8IKN0.pdb.gz	Q8IKN0_PLAF7 FYVE and coiled-coil domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1460100 PE=4 SV=1
4	AFDB:A2A8R0	0.127	0.044	1.755E-6	1397	0.098	0.033	A2A8R0.pdb.gz	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
5	AFDB:A5PMI2	0.123	0.050	2.272E-6	1216	0.093	0.036	A5PMI2.pdb.gz	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
6	AFDB:Q7K9H6	0.131	0.049	1.574E-5	1343	0.157	0.055	Q7K9H6.pdb.gz	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
7	AFDB:Q6AYH3	0.106	0.129	5.363E-5	381	0.125	0.155	Q6AYH3.pdb.gz	RNF34_RAT E3 ubiquitin-protein ligase RNF34 OS=Rattus norvegicus OX=10116 GN=Rnf34 PE=1 SV=1
8	AFDB:O96838	0.122	0.036	1.606E-4	1809	0.113	0.029	O96838.pdb.gz	FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=fab1 PE=1 SV=2
9	AFDB:G5ED98	0.103	0.033	2.365E-4	1497	0.091	0.029	G5ED98.pdb.gz	G5ED98_CAEEL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Caenorhabditis elegans OX=6239 GN=ppk-3 PE=1 SV=1
10	AFDB:A0A0G2KJF1	0.069	0.055	3.266E-4	624	0.100	0.075	A0A0G2KJF1.pdb.gz
11	PDB:7r5jA0	0.071	0.046	1.025	818	0.070	0.040	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:5gm6a	0.081	0.269	1.327	123	0.030	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:6ydhA	0.070	0.326	1.510	62	0.025	0.194	6ydhA.pdb.gz
14	PDB:5dkaA	0.066	0.298	1.718	96	0.017	0.083	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:5z8lA	0.076	0.164	1.832	204	0.023	0.054	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
16	PDB:3ojaA	0.082	0.080	1.954	482	0.079	0.077	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
17	PDB:5yzgY	0.106	0.158	2.085	204	0.066	0.152	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:7z36B	0.075	0.079	2.085	446	0.083	0.087	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
19	PDB:4kfzB	0.078	0.196	2.530	148	0.036	0.115	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
20	PDB:7qe7S	0.079	0.218	2.698	100	0.034	0.160	7qe7S.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96K21	0.0	959	471	1.000	1.000	ANCHR_HUMAN Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19 PE=1 SV=3
2	Q9VML2	1.42e-06	53.5	3489	0.047	0.006	Q9VML2_DROME Blue cheese OS=Drosophila melanogaster OX=7227 GN=bchs PE=4 SV=4
3	Q9HCC9	1.68e-06	53.1	887	0.042	0.023	LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens OX=9606 GN=ZFYVE28 PE=1 SV=3
4	I3L1P5	2.95e-06	52.0	536	0.047	0.041	I3L1P5_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=2
5	A0A0S2Z4R4	3.28e-06	52.0	777	0.042	0.026	A0A0S2Z4R4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=2 SV=1
6	O14964	3.28e-06	52.0	777	0.042	0.026	HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
7	A5PMI2	3.45e-06	52.0	1216	0.047	0.018	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
8	A0A0S2Z4Q4	4.63e-06	51.6	699	0.042	0.029	A0A0S2Z4Q4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
9	Q7K9H6	5.17e-06	51.6	1343	0.064	0.022	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
10	Q99LI8	5.27e-06	51.6	775	0.042	0.026	HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus OX=10090 GN=Hgs PE=1 SV=2
11	Q960V6	5.54e-06	51.6	1343	0.064	0.022	Q960V6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=2 SV=1
12	A2A8R0	7.94e-06	51.2	1397	0.045	0.015	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
13	E1C6T3	8.97e-06	50.8	1416	0.045	0.015	E1C6T3_CHICK Zinc finger FYVE domain-containing protein OS=Gallus gallus OX=9031 GN=ZFYVE9 PE=4 SV=2
14	O95405	9.46e-06	50.8	1425	0.045	0.015	ZFYV9_HUMAN Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 PE=1 SV=2
15	A0A8I5Y8V2	1.04e-05	50.4	1134	0.045	0.019	A0A8I5Y8V2_RAT Phosphatidylinositol-3-phosphate phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
16	A0A8I6AFY1	1.12e-05	50.4	1216	0.045	0.017	A0A8I6AFY1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
17	Q9JJ50	1.17e-05	50.4	776	0.045	0.027	HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus OX=10116 GN=Hgs PE=1 SV=1
18	Q9NYA4	1.18e-05	50.4	1195	0.045	0.018	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2
19	A0A8I6AT43	1.20e-05	50.4	1195	0.045	0.018	A0A8I6AT43_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
20	Q960X8	1.20e-05	50.4	760	0.047	0.029	HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster OX=7227 GN=Hrs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	4.3e-06	38.1	FYVE zinc finger
2	PF04032 Rpr2	4.4e+02	12.6	RNAse P Rpr2/Rpp21/SNM1 subunit domain
3	PF00643 zf-B_box	5.7e+02	12.1	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347498

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000238497	0.902	Vacuolar protein sorting-associated protein 4B
2	9606.ENSP00000297265	0.893	Charged multivesicular body protein 4c
3	9606.ENSP00000254950	0.754	Vacuolar protein sorting-associated protein 4A
4	9606.ENSP00000251968	0.733	Tumor susceptibility gene 101 protein
5	9606.ENSP00000345195	0.722	Ubiquilin-2
6	9606.ENSP00000388107	0.720	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000379500	0.709	Ubiquitin-conjugating enzyme E2 variant 3
8	9606.ENSP00000246548	0.707	SUMO-activating enzyme subunit 2
9	9606.ENSP00000366746	0.706	Signal transducing adapter molecule 1
10	9606.ENSP00000357292	0.705	Ubiquilin-4
11	9606.ENSP00000263904	0.701	Signal transducing adapter molecule 2
12	9606.ENSP00000326817	0.698	Leucine-rich repeat-containing protein 57
13	9606.ENSP00000428209	0.683	Ubiquitin-conjugating enzyme E2 variant 2
14	9606.ENSP00000464893	0.683	RING finger protein unkempt homolog
15	9606.ENSP00000360613	0.676	Ubiquitin-conjugating enzyme E2 A
16	9606.ENSP00000343001	0.673	Ubiquitin conjugation factor E4 B
17	9606.ENSP00000478927	0.670	Transcriptional coactivator YAP1
18	9606.ENSP00000317468	0.667	Charged multivesicular body protein 6
19	9606.ENSP00000253794	0.660	Vacuolar protein-sorting-associated protein 25
20	9606.ENSP00000366819	0.655	Ubiquitin carboxyl-terminal hydrolase isozyme L3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032266	1.000	phosphatidylinositol-3-phosphate binding
GO:0003824	0.384	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0000278	0.979	mitotic cell cycle
GO:0051716	0.976	cellular response to stimulus
GO:0010564	0.975	regulation of cell cycle process
GO:0048523	0.965	negative regulation of cellular process
GO:0022402	0.964	cell cycle process
GO:1901987	0.960	regulation of cell cycle phase transition
GO:1902749	0.953	regulation of cell cycle G2/M phase transition
GO:1903047	0.948	mitotic cell cycle process
GO:0007154	0.947	cell communication
GO:0007165	0.943	signal transduction
GO:0010948	0.942	negative regulation of cell cycle process
GO:1901988	0.933	negative regulation of cell cycle phase transition
GO:0035556	0.931	intracellular signal transduction
GO:0000075	0.923	cell cycle checkpoint signaling
GO:1901990	0.916	regulation of mitotic cell cycle phase transition
GO:0051302	0.891	regulation of cell division
GO:0010389	0.887	regulation of G2/M transition of mitotic cell cycle
GO:0045930	0.865	negative regulation of mitotic cell cycle
GO:0032465	0.854	regulation of cytokinesis
GO:1901991	0.854	negative regulation of mitotic cell cycle phase transition
GO:0007093	0.848	mitotic cell cycle checkpoint signaling
GO:1902750	0.822	negative regulation of cell cycle G2/M phase transition
GO:0010972	0.810	negative regulation of G2/M transition of mitotic cell cycle
GO:0051782	0.764	negative regulation of cell division
GO:0032501	0.597	multicellular organismal process
GO:0032502	0.590	developmental process
GO:0048856	0.505	anatomical structure development
GO:0007275	0.463	multicellular organism development
GO:0008152	0.399	metabolic process
GO:0071704	0.365	organic substance metabolic process
GO:0044238	0.328	primary metabolic process
GO:0006807	0.322	nitrogen compound metabolic process
GO:0043170	0.313	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0015630	0.996	microtubule cytoskeleton
GO:0030496	0.993	midbody
GO:0032154	0.991	cleavage furrow
GO:0005813	0.991	centrosome
GO:0043227	0.957	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005829	0.945	cytosol
GO:0005634	0.826	nucleus
GO:0070013	0.715	intracellular organelle lumen
GO:0031981	0.564	nuclear lumen
GO:0005654	0.315	nucleoplasm
GO:0012505	0.300	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]