StarFunc result for job id Q96K37

User Input

>input (410 residues)
MAAAAVGAGHGAGGPGAASSSGGAREGARVAALCLLWYALSAGGNVVNKVILSAFPFPVT
VSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKY
FASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLAT
VTELSFDMWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVL
VDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRI
MVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKER
HRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7G7	0.910	0.910	5.518E-50	410	1.000	1.000	A0A024R7G7.pdb.gz
2	AFDB:H7C1I0	0.667	0.789	2.550E-35	344	0.839	1.000	H7C1I0.pdb.gz	H7C1I0_HUMAN Solute carrier family 35 member E1 (Fragment) OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
3	AFDB:Q5VQL3	0.667	0.694	1.719E-17	393	0.259	0.270	Q5VQL3.pdb.gz	PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1
4	AFDB:Q84QU8	0.651	0.655	6.772E-17	407	0.251	0.253	Q84QU8.pdb.gz	PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT2 PE=2 SV=1
5	AFDB:Q69VR7	0.675	0.678	1.665E-16	408	0.232	0.233	Q69VR7.pdb.gz	PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT1 PE=2 SV=1
6	AFDB:Q8RXN3	0.673	0.676	1.665E-16	408	0.227	0.228	Q8RXN3.pdb.gz	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
7	AFDB:Q9M5A9	0.658	0.693	3.759E-16	388	0.239	0.253	Q9M5A9.pdb.gz	GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT1 PE=1 SV=1
8	AFDB:Q9ZSR7	0.703	0.703	8.486E-16	410	0.210	0.210	Q9ZSR7.pdb.gz	TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPT PE=1 SV=1
9	AFDB:O94695	0.684	0.629	1.360E-15	449	0.268	0.245	O94695.pdb.gz	YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC83.11 PE=1 SV=2
10	AFDB:Q94B38	0.647	0.682	1.481E-15	388	0.222	0.235	Q94B38.pdb.gz	GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT2 PE=2 SV=2
11	PDB:6xboA	0.448	0.549	1.451E-6	319	0.117	0.150	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
12	PDB:5ogeG	0.481	0.618	3.314E-5	306	0.095	0.127	5ogeG.pdb.gz
13	PDB:6li9B	0.124	0.116	7.740E-2	458	0.127	0.114	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
14	PDB:4kjrA	0.145	0.171	1.188E-1	325	0.098	0.123	4kjrA.pdb.gz
15	PDB:7wsmA	0.178	0.161	1.294E-1	464	0.088	0.078	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
16	PDB:4yzfA	0.135	0.120	1.351E-1	475	0.139	0.120	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
17	PDB:5j4nA	0.137	0.132	1.824E-1	437	0.132	0.124	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
18	PDB:7n98A	0.120	0.109	1.904E-1	473	0.088	0.076	7n98A.pdb.gz
19	PDB:7ccsB	0.113	0.105	2.569E-1	454	0.090	0.081	7ccsB.pdb.gz
20	PDB:3lrbA	0.182	0.182	2.922E-1	410	0.085	0.085	3lrbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C1I0	0.0	681	344	0.839	1.000	H7C1I0_HUMAN Solute carrier family 35 member E1 (Fragment) OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
2	Q96K37	0.0	831	410	1.000	1.000	S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
3	Q5VQL3	1.92e-40	150	393	0.254	0.265	PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1
4	Q84QU8	1.07e-39	148	407	0.259	0.260	PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT2 PE=2 SV=1
5	Q69VR7	1.19e-37	142	408	0.241	0.243	PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT1 PE=2 SV=1
6	Q9M5A9	1.41e-36	139	388	0.263	0.278	GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT1 PE=1 SV=1
7	O94695	9.25e-36	138	449	0.271	0.247	YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC83.11 PE=1 SV=2
8	Q8H0T6	8.49e-33	129	383	0.241	0.258	PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT2 PE=2 SV=1
9	Q8C811	6.48e-32	127	405	0.212	0.215	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
10	Q94B38	7.09e-32	126	388	0.239	0.253	GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT2 PE=2 SV=2
11	Q9ZSR7	1.30e-30	123	410	0.244	0.244	TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPT PE=1 SV=1
12	Q9LF61	4.41e-30	122	417	0.237	0.233	XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=XPT PE=1 SV=1
13	Q8RXN3	8.44e-30	121	408	0.246	0.248	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
14	Q9SFE9	9.52e-25	105	341	0.210	0.252	GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana OX=3702 GN=GONST5 PE=2 SV=1
15	Q9C521	1.69e-24	105	336	0.215	0.262	UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana OX=3702 GN=UDP-GALT1 PE=2 SV=1
16	Q9FYE5	3.58e-20	92.4	309	0.190	0.252	UUAT1_ARATH UDP-URONIC ACID TRANSPORTER 1 OS=Arabidopsis thaliana OX=3702 GN=UUAT1 PE=1 SV=1
17	Q6DBP3	7.05e-20	91.7	309	0.183	0.243	PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana OX=3702 GN=At5g05820 PE=2 SV=1
18	I1VCA5	8.19e-20	91.3	308	0.190	0.253	I1VCA5_ARATH Putative nucleotide-sugar transporter (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NST PE=2 SV=1
19	Q5XF09	8.19e-20	91.3	308	0.190	0.253	PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana OX=3702 GN=At3g11320 PE=2 SV=1
20	Q3E6T0	3.74e-19	90.1	349	0.239	0.281	PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana OX=3702 GN=At5g25400 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00892 EamA	3.3e-09	48.5	EamA-like transporter family
2	PF10639 TMEM234	36	15.8	Putative transmembrane family 234
3	PF03151 TPT	4.9e-89	310.1	Triose-phosphate Transporter family
4	PF08449 UAA	0.087	23.6	UAA transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470652

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340761	0.748	BRI3-binding protein
2	9606.ENSP00000367770	0.717	UDP-xylose and UDP-N-acetylglucosamine transporter
3	9606.ENSP00000326693	0.707	Mitochondrial coenzyme A transporter SLC25A42
4	9606.ENSP00000318960	0.701	Solute carrier family 35 member C2
5	9606.ENSP00000269878	0.696	Calcium and integrin binding family member 3
6	9606.ENSP00000402756	0.696	Nuclear receptor 2C2-associated protein
7	9606.ENSP00000439856	0.680	Calcium homeostasis endoplasmic reticulum protein
8	9606.ENSP00000359172	0.665	UDP-N-acetylglucosamine transporter
9	9606.ENSP00000368981	0.655	Adenosine 3'-phospho 5'-phosphosulfate transporter 2
10	9606.ENSP00000417654	0.647	Probable UDP-sugar transporter protein SLC35A5
11	9606.ENSP00000240333	0.639	Solute carrier family 35 member B1
12	9606.ENSP00000305071	0.637	DNA-binding protein RFXANK
13	9606.ENSP00000247003	0.628	Probable ATP-dependent RNA helicase DDX49
14	9606.ENSP00000419475	0.628	COMM domain-containing protein 2
15	9606.ENSP00000269740	0.619	Zinc transporter ZIP3
16	9606.ENSP00000235345	0.617	UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
17	9606.ENSP00000424566	0.616	Probable UDP-sugar transporter protein SLC35A4
18	9606.ENSP00000253270	0.613	UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter
19	9606.ENSP00000354774	0.611	SPRY domain containing 7
20	9606.ENSP00000313318	0.606	GDP-fucose transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	0.999	transmembrane transporter activity
GO:0005515	0.998	protein binding
GO:1901505	0.985	carbohydrate derivative transmembrane transporter activity
GO:0008514	0.974	organic anion transmembrane transporter activity
GO:0015932	0.922	nucleobase-containing compound transmembrane transporter activity
GO:0015605	0.842	organophosphate ester transmembrane transporter activity
GO:0015165	0.841	pyrimidine nucleotide-sugar transmembrane transporter activity
GO:0015291	0.740	secondary active transmembrane transporter activity
GO:0046943	0.521	carboxylic acid transmembrane transporter activity
GO:0015297	0.498	antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071702	0.991	organic substance transport
GO:0055085	0.934	transmembrane transport
GO:1901264	0.772	carbohydrate derivative transport
GO:0015711	0.729	organic anion transport
GO:0071705	0.413	nitrogen compound transport
GO:0008152	0.361	metabolic process
GO:0044238	0.307	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.724	membrane
GO:0031090	0.512	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]