StarFunc result for job id Q96K62

User Input

>input (511 residues)
MAAAEAVHHIHLQNFSRSLLETLNGQRLGGHFCDVTVRIREASLRAHRCVLAAGSPFFQD
KLLLGHSEIRVPPVVPAQTVRQLVEFLYSGSLVVAQGEALQVLTAASVLRIQTVIDECTQ
IIARARAPGTSAPTPLPTPVPPPLAPAQLRHRLRHLLAARPPGHPGAAHSRKQRQPARLQ
LPAPPTPAKAEGPDADPSLSAAPDDRGDEDDEESDDETDGEDGEGGGPGEGQAPPSFPDC
AAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPE
GCPTETPVQPDCILSGSRPPGVKTPGPPVALFPFHLGAPGPPAPPPSAPSGPAPAPPPAF
YPTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTYECSHCRKTFSSRKNYTK
HMFIHSGEKPHQCAVCWRSFSLRDYLLKHMVTHTGVRAFQCAVCAKRFTQKSSLNVHMRT
HRPERAPCPACGKVFSHRALLERHLAAHPAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96K62	0.999	0.999	1.726E-81	511	1.000	1.000	Q96K62.pdb.gz	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
2	AFDB:O15209	0.237	0.192	1.449E-23	634	0.282	0.227	O15209.pdb.gz	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
3	AFDB:O43298	0.207	0.226	1.923E-21	467	0.194	0.212	O43298.pdb.gz	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
4	AFDB:Q8NCP5	0.234	0.213	1.409E-20	570	0.219	0.196	Q8NCP5.pdb.gz	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
5	AFDB:F1RAC1	0.189	0.092	9.278E-15	1146	0.245	0.109	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
6	AFDB:Q8UVQ4	0.200	0.147	2.294E-14	701	0.204	0.148	Q8UVQ4.pdb.gz	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
7	AFDB:Q9ULJ3	0.209	0.103	4.195E-14	1066	0.227	0.109	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
8	AFDB:Q86T24	0.207	0.159	7.670E-14	672	0.192	0.146	Q86T24.pdb.gz	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
9	AFDB:Q8BN78	0.227	0.175	1.243E-13	671	0.202	0.154	Q8BN78.pdb.gz	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
10	AFDB:Q96JB3	0.205	0.172	1.897E-13	615	0.262	0.218	Q96JB3.pdb.gz	HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2 PE=1 SV=2
11	PDB:6wcqC	0.218	0.799	1.353E-9	130	0.057	0.223	6wcqC.pdb.gz
12	PDB:3w5kB	0.092	0.270	1.458E-4	110	0.068	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:7mk2A	0.187	0.263	4.067E-4	354	0.049	0.071	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
14	PDB:2p1nD	0.157	0.581	6.936E-3	127	0.035	0.142	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
15	PDB:5vztA	0.164	0.540	7.826E-3	145	0.039	0.138	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
16	PDB:6gypD	0.161	0.504	3.136E-2	151	0.039	0.132	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
17	PDB:3ogkA	0.165	0.544	4.784E-2	145	0.033	0.117	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
18	PDB:6sgaFS	0.136	0.241	6.034E-1	277	0.033	0.061	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
19	PDB:6ydhA	0.041	0.212	6.809E-1	62	0.027	0.226	6ydhA.pdb.gz
20	PDB:2a79B	0.141	0.265	1.039	259	0.020	0.039	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96K62	0.0	1019	511	1.000	1.000	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
2	Q9HC78	2.60e-56	202	741	0.278	0.192	ZBT20_HUMAN Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3
3	Q8K0L9	2.87e-53	194	741	0.266	0.184	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
4	P20385	1.64e-23	105	510	0.115	0.116	CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster OX=7227 GN=Cf2 PE=2 SV=3
5	Q6P2D0	3.66e-23	103	407	0.102	0.128	ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens OX=9606 GN=ZFP1 PE=1 SV=2
6	Q923T4	3.71e-22	101	484	0.106	0.112	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
7	Q9UDV7	4.85e-22	102	671	0.084	0.064	ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens OX=9606 GN=ZNF282 PE=1 SV=3
8	Q06732	7.10e-22	101	778	0.114	0.075	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
9	E9Q8G5	7.24e-22	101	680	0.102	0.076	ZFOI1_MOUSE Zinc finger protein OBI1 OS=Mus musculus OX=10090 GN=ObI1 PE=1 SV=1
10	Q9C0F3	7.65e-22	100	470	0.102	0.111	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
11	Q96LW9	1.16e-21	99.4	406	0.094	0.118	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
12	O15209	1.37e-21	100	634	0.090	0.073	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
13	Q8CJ78	1.75e-21	100	1038	0.092	0.045	ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus OX=10090 GN=Znf628 PE=1 SV=2
14	Q6P9G9	1.79e-21	99.8	518	0.110	0.108	ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens OX=9606 GN=ZNF449 PE=1 SV=3
15	Q86TJ5	2.24e-21	99.8	538	0.100	0.095	ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens OX=9606 GN=ZNF554 PE=1 SV=1
16	Q5EBL2	2.42e-21	100	1059	0.092	0.044	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
17	Q9ULD5	2.47e-21	100	831	0.100	0.061	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
18	Q9NQZ8	3.62e-21	98.6	489	0.090	0.094	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
19	P17041	3.66e-21	95.5	273	0.090	0.168	ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens OX=9606 GN=ZNF32 PE=1 SV=2
20	Q8NDW4	5.31e-21	98.6	579	0.115	0.102	ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens OX=9606 GN=ZNF248 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	4e-17	73.8	BTB/POZ domain
2	PF10013 DUF2256	87	14.7	Uncharacterized protein conserved in bacteria (DUF2256)
3	PF00096 zf-C2H2	1.1e-14	65.1	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	2.1	19.5	zinc-finger C2H2-type
5	PF12756 zf-C2H2_2	35	16.1	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	1.8e-07	42.4	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	0.79	21.1	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	0.00078	30.9	Zinc-finger double-stranded RNA-binding
9	PF05605 zf-Di19	2.5e+02	13.4	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	1.5e-13	61.7	Zinc-finger double domain
11	PF12874 zf-met	0.045	25.4	Zinc-finger of C2H2 type
12	PF18439 zf_UBZ	6.7e+02	11.4	Ubiquitin-Binding Zinc Finger
13	PF09723 Zn-ribbon_8	14	17.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296600	0.608	Zinc finger protein 474
2	9606.ENSP00000392335	0.601	Putative zinc finger protein 487
3	9606.ENSP00000463159	0.519	Uncharacterized protein C19orf47
4	9606.ENSP00000351631	0.512	Protein FAM76B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.451	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0019219	0.961	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.960	regulation of gene expression
GO:0051252	0.894	regulation of RNA metabolic process
GO:0006357	0.855	regulation of transcription by RNA polymerase II
GO:0048519	0.840	negative regulation of biological process
GO:0009987	0.833	cellular process
GO:0048523	0.731	negative regulation of cellular process
GO:0051172	0.599	negative regulation of nitrogen compound metabolic process
GO:0031324	0.599	negative regulation of cellular metabolic process
GO:0010605	0.574	negative regulation of macromolecule metabolic process
GO:1902679	0.489	negative regulation of RNA biosynthetic process
GO:0000122	0.483	negative regulation of transcription by RNA polymerase II
GO:0008152	0.395	metabolic process
GO:0071704	0.385	organic substance metabolic process
GO:0044238	0.343	primary metabolic process
GO:0006807	0.333	nitrogen compound metabolic process
GO:0043170	0.323	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]