StarFunc result for job id Q96K76

User Input

>input (1375 residues)
MVPGEENQLVPKEDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDTTNSKTVNERI
TLNLPASTPVRKLFEDVANKVGYINGTFDLVWGNGINTADMAPLDHTSDKSLLDANFEPG
KKNFLHLTDKDGEQPQILLEDSSAGEDSVHDRFIGPLPREGSGGSTSDYVSQSYSYSSIL
NKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLF
VLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINEL
YQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPN
QYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF
IDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGL
EKNSLIYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSS
GSRGYYSSAFASSTNAYMLIYRLKDPARNAKFLEVDEYPEHIKNLVQKERELEEQEKRQR
EIERNTCKIKLFCLHPTKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVK
YDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHV
VDLKAESVAAPITVRAYLNQTVTEFKQLISKAIHLPAETMRIVLERCYNDLRLLSVSSKT
LKAEGFFRSNKVFVESSETLDYQMAFADSHLWKLLDRHANTIRLFVLLPEQSPVSYSKRT
AYQKAGGDSGNVDDDCERVKGPVGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKST
ETSDFENIESPLNERDSSASVDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSD
ILSSSHSSDTLCNADNAQIPLANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYD
ESGKSRGEMQYMYFKAEPYAADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHF
KVFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKF
LLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDI
NISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLS
EISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDK
TEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BY87	0.801	0.801	0.000	1376	0.951	0.950	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
2	AFDB:Q24574	0.355	0.323	4.421E-100	1556	0.318	0.281	Q24574.pdb.gz	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
3	AFDB:Q9WTV6	0.225	0.810	1.722E-28	368	0.073	0.272	Q9WTV6.pdb.gz	UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus OX=10090 GN=Usp18 PE=1 SV=2
4	AFDB:Q8NB14	0.226	0.295	1.407E-25	1042	0.089	0.117	Q8NB14.pdb.gz	UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens OX=9606 GN=USP38 PE=1 SV=2
5	PDB:5cvnB	0.205	0.824	7.233E-25	321	0.068	0.290	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
6	PDB:5k16B	0.200	0.761	1.382E-23	328	0.069	0.290	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
7	PDB:7yxxA	0.217	0.172	1.624E-23	1754	0.073	0.058	7yxxA.pdb.gz
8	AFDB:E9QFQ5	0.200	0.644	1.957E-23	404	0.071	0.240	E9QFQ5.pdb.gz	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
9	PDB:3mhsA	0.198	0.564	3.831E-23	455	0.066	0.200	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
10	AFDB:E7F4C0	0.199	0.246	1.032E-22	1104	0.122	0.152	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
11	AFDB:Q3LFD5	0.215	0.790	1.862E-22	358	0.066	0.254	Q3LFD5.pdb.gz
12	AFDB:A0A024R8V6	0.199	0.241	1.965E-22	1123	0.113	0.138	A0A024R8V6.pdb.gz
13	PDB:7w3ax	0.201	0.528	6.233E-22	494	0.071	0.196	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
14	AFDB:Q9QZL6	0.199	0.462	6.395E-22	566	0.066	0.161	Q9QZL6.pdb.gz	UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus OX=10090 GN=Usp21 PE=1 SV=1
15	AFDB:A0A1D8PFU3	0.188	0.311	6.747E-22	811	0.076	0.128	A0A1D8PFU3.pdb.gz	A0A1D8PFU3_CANAL Ubiquitin carboxyl-terminal hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DOA4 PE=3 SV=1
16	PDB:8a9kD	0.186	0.840	7.351E-21	285	0.057	0.274	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
17	PDB:7ay1D	0.198	0.750	1.564E-19	341	0.060	0.240	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:4fjcE	0.181	0.534	2.045E-19	434	0.063	0.198	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
19	PDB:5gjqx	0.197	0.712	6.309E-19	355	0.056	0.217	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:4wa6D	0.171	0.534	8.284E-18	415	0.059	0.195	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BY87	0.0	2661	1376	0.946	0.945	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
2	Q96K76	0.0	2861	1375	1.000	1.000	UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3
3	Q24574	2.09e-169	549	1556	0.213	0.188	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
4	Q22240	6.32e-129	434	1326	0.217	0.225	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
5	P50101	5.12e-64	241	1230	0.111	0.124	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
6	Q9UTT1	2.22e-63	238	1129	0.109	0.133	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
7	Q9FPT1	1.89e-57	220	1116	0.106	0.131	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
8	Q84WU2	2.06e-57	219	1115	0.105	0.130	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
9	Q09879	1.38e-56	217	1108	0.102	0.126	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
10	I3ISS5	3.98e-47	187	1103	0.079	0.098	I3ISS5_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
11	F1QUS9	4.27e-47	187	1110	0.079	0.097	F1QUS9_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
12	G3MU83	4.87e-46	184	1134	0.097	0.117	G3MU83_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
13	O45623	5.16e-46	183	1133	0.097	0.117	O45623_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
14	G3MU80	5.42e-46	183	1132	0.097	0.117	G3MU80_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
15	G3MU81	5.57e-46	183	1129	0.097	0.118	G3MU81_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
16	O45624	5.68e-46	183	1130	0.097	0.118	O45624_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
17	Q7JKC3	5.70e-46	183	1135	0.097	0.117	UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=3 SV=1
18	G3MU79	5.79e-46	183	1131	0.097	0.118	G3MU79_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
19	G3MU82	5.96e-46	183	1132	0.097	0.117	G3MU82_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
20	Q4VSI4	1.17e-45	182	1103	0.078	0.097	UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00240 ubiquitin	4.9	18.3	Ubiquitin family
2	PF14560 Ubiquitin_2	0.37	22.6	Ubiquitin-like domain
3	PF00443 UCH	3.2e-49	179.5	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	6.3e-18	77.1	Ubiquitin carboxyl-terminal hydrolase
5	PF19718 USP47_C	6.2e-90	312.5	Ubiquitin carboxyl-terminal hydrolase 47 C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005578662.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005548926.1	0.886	Specifically deubiquitinates 'Lys-120' of histone H2A (H2AK119Ub), a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. Deubiquitination of histone H2A is a prerequisite for subsequent phosphorylation at 'Ser-11' of histone H3 (H3S10ph), and is required for chromosome segregation when cells enter into mitosis. In resting B- and T-lymphocytes, phosphorylation by AURKB leads to enhance its activity, thereby maintaining transcription in resting lymphocytes. Regulates Hox gene expression via histone H2A deubiquitination. Prefers nucleosomal substrates. [...]
2	9541.XP_005558576.1	0.852	F-box/WD repeat-containing protein 11 isoform X1
3	9541.XP_005566293.1	0.774	F-box/WD repeat-containing protein 1A isoform X1
4	9541.XP_005563262.1	0.709	DNA polymerase that functions in several pathways of DNA repair. Involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Also contributes to DNA double-strand break repair by non-homologous end joining and homologous recombination. Has both template-dependent and template- independent (terminal transferase) DNA polymerase activities. Has also a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.
5	9541.XP_005562732.1	0.684	Pericentriolar material 1 protein isoform X1
6	9541.XP_005574580.1	0.680	E3 ubiquitin-protein ligase TRIP12 isoform X1
7	9541.XP_005592454.1	0.662	26S proteasome non-ATPase regulatory subunit 7 isoform X1
8	9541.XP_005592670.1	0.657	C-type lectin superfamily member 1
9	9541.XP_005582939.1	0.656	Belongs to the peptidase C19 family.
10	9541.XP_005561503.1	0.654	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
11	9541.XP_005572937.1	0.634	ATP-dependent 3'-5' DNA helicase, component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. The ATPase activity of XPB/ERCC3, but not its helicase activity, is required for DNA opening. In transcription, TFIIH has an essential role in transc [...]
12	9541.XP_005586583.1	0.628	Zinc finger CCHC domain-containing protein 2
13	9541.XP_005593571.1	0.627	OTU domain-containing protein 5
14	9541.XP_005556661.1	0.620	Uncharacterized protein
15	9541.XP_005595336.1	0.610	Uncharacterized protein
16	9541.XP_005576553.1	0.607	Structural maintenance of chromosomes protein 6 isoform X1
17	9541.XP_005539767.1	0.592	Galectin-8 isoform X1
18	9541.XP_005583517.1	0.583	Schlafen family member 5
19	9541.XP_005571277.1	0.577	Catalytic subunit of the poly(A)-nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly(A) tails of RNA and the activity is stimulated by poly(A)-binding protein (PABP). PAN deadenylation is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degrad [...]
20	9541.XP_005552065.1	0.574	Phosphatase and actin regulator 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0019904	0.994	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.986	cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0070646	0.977	protein modification by small protein removal
GO:0048519	0.970	negative regulation of biological process
GO:0016579	0.961	protein deubiquitination
GO:0023051	0.960	regulation of signaling
GO:0010646	0.959	regulation of cell communication
GO:0051716	0.957	cellular response to stimulus
GO:0048583	0.956	regulation of response to stimulus
GO:0048522	0.943	positive regulation of cellular process
GO:0044237	0.940	cellular metabolic process
GO:0048523	0.936	negative regulation of cellular process
GO:0006950	0.930	response to stress
GO:0009966	0.919	regulation of signal transduction
GO:0080090	0.910	regulation of primary metabolic process
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0031323	0.904	regulation of cellular metabolic process
GO:0006974	0.903	cellular response to DNA damage stimulus
GO:0060255	0.897	regulation of macromolecule metabolic process
GO:0009892	0.886	negative regulation of metabolic process
GO:0044260	0.880	cellular macromolecule metabolic process
GO:0051246	0.876	regulation of protein metabolic process
GO:0010605	0.872	negative regulation of macromolecule metabolic process
GO:0030162	0.863	regulation of proteolysis
GO:0019219	0.812	regulation of nucleobase-containing compound metabolic process
GO:0010941	0.804	regulation of cell death
GO:0051172	0.788	negative regulation of nitrogen compound metabolic process
GO:0080134	0.776	regulation of response to stress
GO:0035556	0.776	intracellular signal transduction
GO:0065009	0.771	regulation of molecular function
GO:0045861	0.746	negative regulation of proteolysis
GO:0048584	0.743	positive regulation of response to stimulus
GO:0042981	0.743	regulation of apoptotic process
GO:0009314	0.738	response to radiation
GO:2001021	0.702	negative regulation of response to DNA damage stimulus
GO:0051726	0.701	regulation of cell cycle
GO:0009968	0.700	negative regulation of signal transduction
GO:0097190	0.655	apoptotic signaling pathway
GO:0010564	0.649	regulation of cell cycle process
GO:1902531	0.649	regulation of intracellular signal transduction
GO:0009411	0.646	response to UV
GO:0060548	0.616	negative regulation of cell death
GO:0009967	0.595	positive regulation of signal transduction
GO:0043066	0.539	negative regulation of apoptotic process
GO:2001242	0.538	regulation of intrinsic apoptotic signaling pathway
GO:0031324	0.532	negative regulation of cellular metabolic process
GO:0071478	0.512	cellular response to radiation
GO:0010468	0.484	regulation of gene expression
GO:2001243	0.476	negative regulation of intrinsic apoptotic signaling pathway
GO:0008630	0.462	intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902229	0.433	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0034641	0.417	cellular nitrogen compound metabolic process
GO:0042221	0.404	response to chemical
GO:0046483	0.402	heterocycle metabolic process
GO:0009056	0.335	catabolic process
GO:0051252	0.330	regulation of RNA metabolic process
GO:0032502	0.325	developmental process
GO:0030111	0.315	regulation of Wnt signaling pathway
GO:1901987	0.307	regulation of cell cycle phase transition
GO:0006355	0.306	regulation of DNA-templated transcription
GO:0007346	0.301	regulation of mitotic cell cycle
GO:0071482	0.300	cellular response to light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.996	protein-containing complex
GO:0031981	0.996	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0005829	0.947	cytosol
GO:1902494	0.933	catalytic complex
GO:1990234	0.747	transferase complex
GO:0000151	0.732	ubiquitin ligase complex
GO:0019005	0.455	SCF ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]