StarFunc result for job id Q96K80

User Input

>input (434 residues)
MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRH
PDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVA
AGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGS
VLPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDGPHFESYEYSLAPPRGVECRLL
EEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVITLSSTAPATEQTLAPTVG
TVATFNHGIAQTHTTLSSQALQPRPVSQQELVAPAGAPAAPPTNAAPPAAPPPPPPHLTP
EITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTY
PIASQSMRITAMPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96K80	1.000	1.000	2.107E-70	434	1.000	1.000	Q96K80.pdb.gz	ZC3HA_HUMAN Zinc finger CCCH domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZC3H10 PE=1 SV=1
2	AFDB:Q9ZUM0	0.086	0.064	1.280E-3	669	0.118	0.076	Q9ZUM0.pdb.gz	C3H17_ARATH Zinc finger CCCH domain-containing protein 17 OS=Arabidopsis thaliana OX=3702 GN=At2g02160 PE=1 SV=1
3	AFDB:Q704P7	0.067	0.060	7.572E-3	484	0.161	0.145	Q704P7.pdb.gz	Q704P7_9HEMI Troponin I protein OS=Lethocerus indicus OX=212017 GN=tnI1 PE=1 SV=1
4	PDB:6dnhC	0.083	0.201	1.464E-2	117	0.051	0.188	6dnhC.pdb.gz	Molecular basis for the recognition of the human AAUAAA polyadenylation signal.
5	AFDB:Q92922	0.092	0.048	2.319E-2	1105	0.136	0.053	Q92922.pdb.gz	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3
6	AFDB:O42115	0.065	0.063	2.645E-2	453	0.147	0.141	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
7	AFDB:Q8IXZ2	0.098	0.052	4.193E-2	948	0.122	0.056	Q8IXZ2.pdb.gz	ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZC3H3 PE=1 SV=3
8	AFDB:Q9LXC6	0.079	0.066	5.108E-2	531	0.136	0.111	Q9LXC6.pdb.gz	Q9LXC6_ARATH Gb
9	AFDB:O96046	0.060	0.052	7.099E-2	559	0.175	0.136	O96046.pdb.gz	O96046_DROME Cortactin OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=2 SV=1
10	AFDB:F1DFN3	0.085	0.090	7.583E-2	402	0.129	0.139	F1DFN3.pdb.gz	F1DFN3_DANRE Syndecan (Fragment) OS=Danio rerio OX=7955 GN=sdc3 PE=2 SV=1
11	AFDB:O07239	0.087	0.066	8.649E-2	620	0.127	0.089	O07239.pdb.gz	O07239_MYCTU Conserved hypothetical proline and threonine rich protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0312 PE=1 SV=1
12	PDB:6eojB	0.057	0.240	5.842E-1	94	0.021	0.096	6eojB.pdb.gz	Architecture of eukaryotic mRNA 3'-end processing machinery.
13	PDB:5gm6R	0.072	0.103	6.664E-1	261	0.051	0.084	5gm6R.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7abiP	0.069	0.103	6.664E-1	237	0.030	0.055	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:7dvqM	0.058	0.117	8.120E-1	191	0.041	0.094	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:7c06A	0.057	0.110	1.057	193	0.023	0.052	7c06A.pdb.gz	Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
17	PDB:1neqA	0.079	0.282	1.468	74	0.032	0.189	1neqA.pdb.gz
18	PDB:6kmlB	0.088	0.227	3.029	138	0.028	0.087	6kmlB.pdb.gz
19	PDB:6id0O	0.066	0.086	3.235	290	0.035	0.052	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:7b93E	0.054	0.102	3.235	215	0.018	0.037	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96K80	0.0	888	434	1.000	1.000	ZC3HA_HUMAN Zinc finger CCCH domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZC3H10 PE=1 SV=1
2	A0A8I5ZVU8	7.66e-09	58.9	302	0.078	0.113	A0A8I5ZVU8_RAT Muscleblind-like splicing regulator 1 OS=Rattus norvegicus OX=10116 GN=Mbnl1 PE=1 SV=1
3	Q8R003	8.40e-07	53.1	342	0.053	0.067	MBNL3_MOUSE Muscleblind-like protein 3 OS=Mus musculus OX=10090 GN=Mbnl3 PE=2 SV=1
4	Q9NUK0	1.17e-06	52.8	354	0.071	0.088	MBNL3_HUMAN Muscleblind-like protein 3 OS=Homo sapiens OX=9606 GN=MBNL3 PE=1 SV=2
5	F1Q5U6	8.36e-06	48.9	208	0.048	0.101	F1Q5U6_DANRE Muscleblind-like protein 2 isoform A OS=Danio rerio OX=7955 GN=fj89c04 PE=4 SV=1
6	A0A2R8QF26	8.68e-06	48.5	190	0.048	0.111	A0A2R8QF26_DANRE Muscleblind-like protein 2 isoform D OS=Danio rerio OX=7955 GN=fj89c04 PE=4 SV=1
7	B8JIV1	3.30e-05	48.1	371	0.048	0.057	B8JIV1_DANRE Muscleblind-like protein 2 isoform C OS=Danio rerio OX=7955 GN=fj89c04 PE=4 SV=1
8	C9JCX1	4.01e-05	45.8	155	0.041	0.116	C9JCX1_HUMAN Muscleblind like splicing regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=MBNL1 PE=1 SV=1
9	B7ZUV4	4.59e-05	47.8	357	0.048	0.059	B7ZUV4_DANRE Mbnl2b protein OS=Danio rerio OX=7955 GN=mbnl2b PE=2 SV=1
10	A5YC70	5.41e-05	47.4	339	0.048	0.062	A5YC70_DANRE Muscleblind-like protein 2 isoform B OS=Danio rerio OX=7955 GN=mbnl2B PE=2 SV=1
11	D6XKD1	6.48e-05	47.4	376	0.088	0.101	D6XKD1_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28I8.10 PE=4 SV=1
12	Q86VM6	8.52e-05	46.6	343	0.041	0.052	Q86VM6_HUMAN MBNL1 protein OS=Homo sapiens OX=9606 GN=MBNL1 PE=1 SV=1
13	H7C4Y1	1.17e-04	45.4	210	0.041	0.086	H7C4Y1_HUMAN Muscleblind like splicing regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=MBNL1 PE=1 SV=1
14	A0A8I5Y4V0	1.95e-04	45.8	381	0.041	0.047	A0A8I5Y4V0_RAT Muscleblind-like splicing regulator 1 OS=Rattus norvegicus OX=10116 GN=Mbnl1 PE=4 SV=1
15	A0A0A0MQX8	2.04e-04	45.8	400	0.041	0.045	A0A0A0MQX8_HUMAN Muscleblind like splicing regulator 1 OS=Homo sapiens OX=9606 GN=MBNL1 PE=1 SV=1
16	Q9NR56	2.16e-04	45.8	388	0.041	0.046	MBNL1_HUMAN Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1 PE=1 SV=2
17	A0A8I6B1J2	2.25e-04	45.4	387	0.041	0.047	A0A8I6B1J2_RAT Muscleblind-like splicing regulator 1 OS=Rattus norvegicus OX=10116 GN=Mbnl1 PE=1 SV=1
18	F1M9N4	2.48e-04	45.4	418	0.041	0.043	F1M9N4_RAT Muscleblind-like splicing regulator 1 OS=Rattus norvegicus OX=10116 GN=Mbnl1 PE=1 SV=3
19	Q8C181	3.47e-04	45.1	373	0.041	0.048	MBNL2_MOUSE Muscleblind-like protein 2 OS=Mus musculus OX=10090 GN=Mbnl2 PE=2 SV=2
20	Q9JKP5	4.36e-04	44.7	341	0.041	0.053	MBNL1_MOUSE Muscleblind-like protein 1 OS=Mus musculus OX=10090 GN=Mbnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	6.5e+02	12.1	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF00170 bZIP_1	1.2	20.6	bZIP transcription factor
3	PF04977 DivIC	8.4e+02	11.2	Septum formation initiator
4	PF17253 DUF5320	2.1e+02	14.5	Family of unknown function (DUF5320)
5	PF05377 FlaC_arch	7e+02	12.0	Flagella accessory protein C (FlaC)
6	PF04899 MbeD_MobD	1.4e+02	14.0	MbeD/MobD like
7	PF16131 Torus	0.0088	28.1	Torus domain
8	PF01166 TSC22	4.2e+02	12.5	TSC-22/dip/bun family
9	PF00642 zf-CCCH	4.2e-08	44.2	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
10	PF14608 zf-CCCH_2	0.00013	33.6	RNA-binding, Nab2-type zinc finger
11	PF15663 zf-CCCH_3	1	20.9	Zinc-finger containing family
12	PF18044 zf-CCCH_4	2.4e-05	35.2	CCCH-type zinc finger
13	PF18345 zf_CCCH_4	8.8e-06	36.8	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000000082

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000002161	0.706	Extended synaptotagmin-like protein 1
2	9555.ENSPANP00000005896	0.700	Fucose-1-phosphate guanylyltransferase
3	9555.ENSPANP00000005718	0.630	RNA binding motif protein 6
4	9555.ENSPANP00000010233	0.629	Factor interacting with PAPOLA and CPSF1
5	9555.ENSPANP00000002463	0.599	annotation not available
6	9555.ENSPANP00000012141	0.583	AT rich interactive domain 5A (MRF1-like)
7	9555.ENSPANP00000020515	0.581	LIM and SH3 protein 1
8	9555.ENSPANP00000008819	0.565	Dedicator of cytokinesis 5
9	9555.ENSPANP00000014890	0.559	Extended synaptotagmin-like protein 2
10	9555.ENSPANP00000004861	0.537	HERV-H LTR-associating 1
11	9555.ENSPANP00000000571	0.534	Zinc finger CCCH-type containing 4
12	9555.ENSPANP00000003302	0.534	RNA binding motif protein 26
13	9555.ENSPANP00000018353	0.526	Protein phosphatase 2, regulatory subunit B, alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035198	0.999	miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0010605	0.984	negative regulation of macromolecule metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0060147	0.981	regulation of post-transcriptional gene silencing
GO:0060966	0.979	regulation of gene silencing by RNA
GO:0048523	0.958	negative regulation of cellular process
GO:0019219	0.952	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.944	regulation of RNA metabolic process
GO:0009893	0.939	positive regulation of metabolic process
GO:1900368	0.931	regulation of post-transcriptional gene silencing by RNA
GO:0060964	0.913	regulation of miRNA-mediated gene silencing
GO:0010604	0.902	positive regulation of macromolecule metabolic process
GO:0031324	0.818	negative regulation of cellular metabolic process
GO:0010628	0.811	positive regulation of gene expression
GO:0051172	0.801	negative regulation of nitrogen compound metabolic process
GO:0045934	0.592	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.582	negative regulation of RNA metabolic process
GO:0010608	0.542	post-transcriptional regulation of gene expression
GO:0070920	0.493	regulation of production of small RNA involved in gene silencing by RNA
GO:0010556	0.483	regulation of macromolecule biosynthetic process
GO:0031326	0.482	regulation of cellular biosynthetic process
GO:0009987	0.465	cellular process
GO:0010629	0.441	negative regulation of gene expression
GO:1903506	0.389	regulation of nucleic acid-templated transcription
GO:0071704	0.363	organic substance metabolic process
GO:0006355	0.344	regulation of DNA-templated transcription
GO:0044238	0.325	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.994	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0005737	0.665	cytoplasm
GO:0005829	0.494	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]