StarFunc result for job id Q96KB5

User Input

>input (322 residues)
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM
MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC
TNEDPKDRPSAAHIVEALETDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96KB5	1.000	1.000	2.419E-64	322	1.000	1.000	Q96KB5.pdb.gz	TOPK_HUMAN Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3
2	AFDB:Q9JJ78	0.921	0.899	1.503E-56	330	0.879	0.858	Q9JJ78.pdb.gz	TOPK_MOUSE Lymphokine-activated killer T-cell-originated protein kinase OS=Mus musculus OX=10090 GN=Pbk PE=1 SV=1
3	PDB:5j0aB	0.712	0.755	3.560E-43	303	0.919	0.977	5j0aB.pdb.gz
4	AFDB:Q2MHE4	0.712	0.596	1.753E-17	390	0.233	0.192	Q2MHE4.pdb.gz	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
5	AFDB:Q9CAD5	0.677	0.261	8.282E-17	883	0.239	0.087	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
6	AFDB:Q9GRC0	0.678	0.626	1.042E-16	351	0.211	0.194	Q9GRC0.pdb.gz	MOS_PATPE Serine/threonine-protein kinase mos OS=Patiria pectinifera OX=7594 GN=mos PE=1 SV=1
7	AFDB:F4HRJ4	0.671	0.368	1.170E-16	609	0.242	0.128	F4HRJ4.pdb.gz	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
8	AFDB:O59790	0.654	0.598	1.239E-16	355	0.205	0.186	O59790.pdb.gz	ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ark1 PE=1 SV=2
9	AFDB:A0A178UKR9	0.659	0.617	1.749E-16	346	0.208	0.194	A0A178UKR9.pdb.gz	A0A178UKR9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g49040 PE=1 SV=1
10	AFDB:Q9LVQ9	0.661	0.533	1.853E-16	405	0.211	0.168	Q9LVQ9.pdb.gz	Q9LVQ9_ARATH Protein kinase ATN1-like protein OS=Arabidopsis thaliana OX=3702 GN=MSN2.10 PE=1 SV=1
11	AFDB:Q7Y236	0.644	0.698	1.963E-16	295	0.196	0.214	Q7Y236.pdb.gz	Q7Y236_GOSHI MAP kinase-like protein OS=Gossypium hirsutum OX=3635 PE=2 SV=1
12	PDB:8dksA	0.594	0.668	1.419E-14	283	0.233	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:6s73A	0.625	0.738	2.997E-14	269	0.202	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
14	PDB:7opmA	0.653	0.585	4.232E-14	362	0.202	0.180	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
15	PDB:7cgaA	0.607	0.567	1.337E-13	347	0.205	0.190	7cgaA.pdb.gz
16	PDB:4eomC	0.629	0.724	1.589E-13	276	0.196	0.228	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:6qx9K	0.593	0.593	1.783E-13	322	0.168	0.168	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:4c0tA	0.639	0.700	2.118E-13	291	0.158	0.175	4c0tA.pdb.gz
19	PDB:1unlA	0.635	0.696	2.244E-13	292	0.174	0.192	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4rerA	0.659	0.477	2.517E-13	459	0.180	0.126	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96KB5	0.0	669	322	1.000	1.000	TOPK_HUMAN Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3
2	Q9JJ78	0.0	593	330	0.879	0.858	TOPK_MOUSE Lymphokine-activated killer T-cell-originated protein kinase OS=Mus musculus OX=10090 GN=Pbk PE=1 SV=1
3	V9HWH0	0.0	669	322	1.000	1.000	V9HWH0_HUMAN Epididymis luminal protein 164 OS=Homo sapiens OX=9606 GN=HEL164 PE=1 SV=1
4	Q8GX94	5.92e-20	92.4	604	0.280	0.149	Q8GX94_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=MQB2.1 PE=1 SV=1
5	Q9M085	1.36e-19	90.9	412	0.230	0.180	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
6	P18161	1.72e-19	91.7	1155	0.267	0.074	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2
7	Q8RWL6	1.97e-19	90.9	570	0.196	0.111	STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana OX=3702 GN=STY17 PE=1 SV=1
8	Q62073	2.62e-19	90.5	579	0.230	0.128	M3K7_MOUSE Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus OX=10090 GN=Map3k7 PE=1 SV=1
9	O43318	2.79e-19	90.5	606	0.230	0.122	M3K7_HUMAN Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7 PE=1 SV=1
10	P0C8E4	2.98e-19	90.5	606	0.230	0.122	M3K7_RAT Mitogen-activated protein kinase kinase kinase 7 OS=Rattus norvegicus OX=10116 GN=Map3k7 PE=1 SV=1
11	O22558	3.08e-19	90.5	546	0.217	0.128	STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana OX=3702 GN=STY8 PE=1 SV=2
12	P10506	4.80e-19	88.6	340	0.261	0.247	BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr1 PE=1 SV=1
13	O73613	5.42e-19	89.7	616	0.230	0.120	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1
14	A8R7E6	8.09e-19	89.4	617	0.227	0.118	CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CERK1 PE=1 SV=1
15	Q503G7	1.16e-18	88.6	544	0.220	0.131	Q503G7_DANRE Mitogen-activated protein kinase kinase kinase 7 OS=Danio rerio OX=7955 GN=zgc:110612 PE=1 SV=1
16	A0A0G2JUN9	1.24e-18	89.0	1078	0.214	0.064	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
17	F1LRA7	1.24e-18	89.0	1100	0.214	0.063	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
18	Q8NG66	2.01e-18	88.2	645	0.295	0.147	NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens OX=9606 GN=NEK11 PE=1 SV=2
19	Q54H46	2.02e-18	88.2	642	0.205	0.103	DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum OX=44689 GN=drkA PE=3 SV=1
20	Q2MHE4	2.04e-18	87.0	390	0.230	0.190	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04655 APH_6_hur	76	14.1	Aminoglycoside/hydroxyurea antibiotic resistance kinase
2	PF00069 Pkinase	2.3e-36	137.1	Protein kinase domain
3	PF17667 Pkinase_fungal	93	13.2	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	4.7e-31	119.6	Protein tyrosine and serine/threonine kinase
5	PF01163 RIO1	2.9e+02	12.4	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006504

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012982	0.966	Cyclin-dependent kinase 1
2	9593.ENSGGOP00000012411	0.916	DNA topoisomerase 2
3	9593.ENSGGOP00000018755	0.893	Non-specific serine/threonine protein kinase
4	9593.ENSGGOP00000027066	0.885	Cyclin B1
5	9593.ENSGGOP00000003409	0.879	DLG associated protein 5
6	9593.ENSGGOP00000010197	0.879	Condensin complex subunit 2
7	9593.ENSGGOP00000020255	0.874	BUB1 mitotic checkpoint serine/threonine kinase B
8	9593.ENSGGOP00000021751	0.873	Polo-like kinase 4
9	9593.ENSGGOP00000024568	0.872	Kinesin family member 11
10	9593.ENSGGOP00000003880	0.869	Centrosomal protein 55kDa
11	9593.ENSGGOP00000008489	0.868	TTK protein kinase
12	9593.ENSGGOP00000022137	0.868	Nucleolar and spindle associated protein 1
13	9593.ENSGGOP00000002571	0.867	Cell division cycle associated 3
14	9593.ENSGGOP00000006958	0.867	Kinesin-like protein
15	9593.ENSGGOP00000017290	0.866	Structural maintenance of chromosomes 2
16	9593.ENSGGOP00000021979	0.865	Baculoviral IAP repeat containing 5
17	9593.ENSGGOP00000023542	0.861	BUB1 mitotic checkpoint serine/threonine kinase
18	9593.ENSGGOP00000014663	0.857	non-SMC condensin I complex, subunit G
19	9593.ENSGGOP00000002134	0.856	Cyclin A2
20	9593.ENSGGOP00000007041	0.856	Aurora kinase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0008152	0.970	metabolic process
GO:0051716	0.964	cellular response to stimulus
GO:0071704	0.937	organic substance metabolic process
GO:0044237	0.935	cellular metabolic process
GO:0044238	0.931	primary metabolic process
GO:0006950	0.908	response to stress
GO:0006807	0.903	nitrogen compound metabolic process
GO:0043170	0.887	macromolecule metabolic process
GO:0019222	0.844	regulation of metabolic process
GO:0048523	0.795	negative regulation of cellular process
GO:0071478	0.760	cellular response to radiation
GO:0009411	0.759	response to UV
GO:0034644	0.751	cellular response to UV
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0007154	0.732	cell communication
GO:0009894	0.718	regulation of catabolic process
GO:0007165	0.718	signal transduction
GO:0080090	0.714	regulation of primary metabolic process
GO:0051171	0.713	regulation of nitrogen compound metabolic process
GO:0031323	0.712	regulation of cellular metabolic process
GO:1901564	0.711	organonitrogen compound metabolic process
GO:0035556	0.703	intracellular signal transduction
GO:0036211	0.696	protein modification process
GO:0010605	0.680	negative regulation of macromolecule metabolic process
GO:0042176	0.672	regulation of protein catabolic process
GO:1903051	0.671	negative regulation of proteolysis involved in protein catabolic process
GO:0031324	0.669	negative regulation of cellular metabolic process
GO:0009895	0.653	negative regulation of catabolic process
GO:0080135	0.639	regulation of cellular response to stress
GO:2000058	0.634	regulation of ubiquitin-dependent protein catabolic process
GO:0033554	0.631	cellular response to stress
GO:0042177	0.630	negative regulation of protein catabolic process
GO:1902531	0.629	regulation of intracellular signal transduction
GO:0031330	0.616	negative regulation of cellular catabolic process
GO:0051174	0.590	regulation of phosphorus metabolic process
GO:0016310	0.582	phosphorylation
GO:0031399	0.578	regulation of protein modification process
GO:2000059	0.568	negative regulation of ubiquitin-dependent protein catabolic process
GO:0071840	0.535	cellular component organization or biogenesis
GO:0016043	0.492	cellular component organization
GO:0048518	0.488	positive regulation of biological process
GO:0048522	0.448	positive regulation of cellular process
GO:0019220	0.447	regulation of phosphate metabolic process
GO:0043408	0.400	regulation of MAPK cascade
GO:0070302	0.399	regulation of stress-activated protein kinase signaling cascade
GO:0006468	0.340	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005737	0.941	cytoplasm
GO:0031981	0.917	nuclear lumen
GO:0005829	0.868	cytosol
GO:0005654	0.344	nucleoplasm
GO:0043232	0.335	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]