StarFunc result for job id Q96KC8

User Input

>input (554 residues)
MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVE
EVQLNFYQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDE
RRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLD
ELLSRKKREKKKKTGSKSVDVSKLGASEKNERLLMKPQWHDLLPCKLGIWFCLTLKALPH
LIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKKPKPEFPVYTPLETTYIQSYD
HGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL
GRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESS
DEESLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYK
LLVELVQKKKQAKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96KC8	1.000	1.000	1.075E-74	554	1.000	1.000	Q96KC8.pdb.gz	DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens OX=9606 GN=DNAJC1 PE=1 SV=1
2	AFDB:Q61712	0.258	0.259	2.109E-61	552	0.848	0.851	Q61712.pdb.gz	DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus OX=10090 GN=Dnajc1 PE=1 SV=1
3	AFDB:Q9VWL4	0.202	0.213	1.127E-23	522	0.307	0.326	Q9VWL4.pdb.gz	Q9VWL4_DROME GH07340p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7556 PE=1 SV=1
4	AFDB:Q9LHS5	0.115	0.097	3.949E-10	663	0.206	0.172	Q9LHS5.pdb.gz	Q9LHS5_ARATH Cell division related protein-like OS=Arabidopsis thaliana OX=3702 GN=ATGLSA2 PE=1 SV=1
5	AFDB:E7FF48	0.109	0.037	5.942E-4	2315	0.179	0.043	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
6	PDB:6byrA	0.111	0.151	2.250E-3	405	0.047	0.064	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
7	AFDB:Q9Y618	0.103	0.031	7.067E-3	2514	0.171	0.038	Q9Y618.pdb.gz	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
8	PDB:2cjjA	0.093	0.792	2.168E-2	63	0.032	0.286	2cjjA.pdb.gz
9	AFDB:Q5VVJ2	0.087	0.062	3.432E-2	828	0.079	0.053	Q5VVJ2.pdb.gz	MYSM1_HUMAN Deubiquitinase MYSM1 OS=Homo sapiens OX=9606 GN=MYSM1 PE=1 SV=1
10	AFDB:Q9QYP6	0.081	0.109	4.467E-2	405	0.085	0.116	Q9QYP6.pdb.gz	AZI2_MOUSE 5-azacytidine-induced protein 2 OS=Mus musculus OX=10090 GN=Azi2 PE=1 SV=1
11	PDB:2y4uA	0.100	0.129	4.778E-2	424	0.047	0.061	2y4uA.pdb.gz
12	PDB:7x3kA	0.117	0.237	5.596E-2	262	0.051	0.107	7x3kA.pdb.gz
13	AFDB:A0A1W2PRG3	0.100	0.140	5.813E-2	368	0.070	0.106	A0A1W2PRG3.pdb.gz	A0A1W2PRG3_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
14	AFDB:B6VDZ5	0.092	0.066	5.813E-2	842	0.105	0.069	B6VDZ5.pdb.gz	B6VDZ5_ONCMY Sodium/hydrogen exchanger OS=Oncorhynchus mykiss OX=8022 GN=NHE3b PE=2 SV=1
15	PDB:5y88T	0.096	0.431	1.880E-1	107	0.047	0.243	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
16	PDB:1fpoA	0.120	0.358	9.130E-1	171	0.034	0.111	1fpoA.pdb.gz
17	PDB:4zzlA	0.074	0.253	1.014	146	0.029	0.110	4zzlA.pdb.gz
18	PDB:5vb2D	0.093	0.162	1.718	268	0.060	0.123	5vb2D.pdb.gz
19	PDB:2cg4A	0.083	0.276	1.909	149	0.009	0.034	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:8escS	0.083	0.144	1.909	268	0.052	0.108	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61712	0.0	894	552	0.845	0.848	DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus OX=10090 GN=Dnajc1 PE=1 SV=1
2	Q96KC8	0.0	1129	554	1.000	1.000	DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens OX=9606 GN=DNAJC1 PE=1 SV=1
3	Q9VWL4	1.23e-55	197	522	0.227	0.241	Q9VWL4_DROME GH07340p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7556 PE=1 SV=1
4	Q9P7C1	1.54e-18	88.6	303	0.094	0.172	YKU3_SCHPO Uncharacterized J domain-containing protein C2E1P5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.03 PE=3 SV=1
5	Q9UBS4	8.15e-15	78.2	358	0.085	0.131	DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1
6	Q6TUG0	8.37e-15	78.2	358	0.085	0.131	DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus OX=10116 GN=Dnajb11 PE=2 SV=1
7	Q99KV1	3.14e-14	76.6	358	0.083	0.128	DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus OX=10090 GN=Dnajb11 PE=1 SV=1
8	Q940V1	4.49e-14	76.6	447	0.061	0.076	Q940V1_ARATH AT4g39960/T5J17_130 OS=Arabidopsis thaliana OX=3702 GN=DJA5 PE=1 SV=1
9	Q54VQ1	1.02e-13	75.5	411	0.065	0.088	Q54VQ1_DICDI Heat shock protein OS=Dictyostelium discoideum OX=44689 GN=ddj1 PE=3 SV=1
10	Q5JNB5	4.97e-13	73.6	471	0.061	0.072	DJC15_ORYSJ DnaJ protein P58IPK homolog B OS=Oryza sativa subsp. japonica OX=39947 GN=P58B PE=1 SV=1
11	C9JUL4	7.80e-13	68.9	172	0.058	0.186	C9JUL4_HUMAN DnaJ heat shock protein family (Hsp40) member B4 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
12	Q8NHS0	9.29e-13	70.1	232	0.069	0.164	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
13	Q6DHR2	1.31e-12	71.2	316	0.069	0.120	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
14	Q9SJZ7	1.65e-12	72.0	442	0.054	0.068	DNJA6_ARATH Chaperone protein dnaJ A6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DJA6 PE=2 SV=2
15	A0A0P0VG31	2.09e-12	71.6	476	0.060	0.069	DJC16_ORYSJ DnaJ protein P58IPK homolog A OS=Oryza sativa subsp. japonica OX=39947 GN=P58A PE=1 SV=1
16	E9PH18	2.42e-12	68.6	211	0.061	0.161	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
17	Q20774	2.65e-12	70.5	331	0.052	0.088	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
18	Q99543	3.03e-12	71.6	621	0.058	0.052	DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4
19	P9WNV7	3.30e-12	70.5	382	0.054	0.079	DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dnaJ2 PE=1 SV=1
20	P54103	3.90e-12	71.2	621	0.058	0.052	DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus OX=10090 GN=Dnajc2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	5.7e-19	79.3	DnaJ domain
2	PF14018 DUF4234	4.2e+02	12.5	Domain of unknown function (DUF4234)
3	PF10545 MADF_DNA_bdg	3.8e+02	12.9	Alcohol dehydrogenase transcription factor Myb/SANT-like
4	PF00249 Myb_DNA-binding	3.4e-09	48.1	Myb-like DNA-binding domain
5	PF13921 Myb_DNA-bind_6	0.057	25.0	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.995	78 kDa glucose-regulated protein
2	9606.ENSP00000297185	0.887	Stress-70 protein, mitochondrial
3	9606.ENSP00000432083	0.871	Heat shock cognate 71 kDa protein
4	9606.ENSP00000357998	0.822	Translocation protein SEC63 homolog
5	9606.ENSP00000376793	0.812	Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
6	9606.ENSP00000358211	0.785	Heat shock protein family A member 12A
7	9606.ENSP00000450540	0.739	Alpha-1-antichymotrypsin
8	9606.ENSP00000238146	0.697	ATP-dependent RNA helicase DDX55
9	9606.ENSP00000337194	0.685	Serine/threonine-protein kinase PRP4 homolog
10	9606.ENSP00000360108	0.680	Putative tyrosine-protein phosphatase auxilin
11	9606.ENSP00000368356	0.673	Serine/threonine-protein kinase D3
12	9606.ENSP00000327323	0.667	Threonine synthase-like 2
13	9606.ENSP00000480150	0.662	Hypoxia up-regulated protein 1
14	9606.ENSP00000254963	0.652	Heat shock protein family A member 12B
15	9606.ENSP00000310042	0.641	Zinc finger protein 622
16	9606.ENSP00000307411	0.637	Protein AF-10
17	9606.ENSP00000295119	0.621	Nucleoporin NUP53
18	9606.ENSP00000016171	0.620	Cytochrome c oxidase assembly protein COX15 homolog
19	9606.ENSP00000359345	0.618	60S ribosomal protein L5
20	9606.ENSP00000302961	0.614	Heat shock protein family A member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001671	0.999	ATPase activator activity
GO:0003676	0.682	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0051246	0.980	regulation of protein metabolic process
GO:0009987	0.925	cellular process
GO:0048519	0.876	negative regulation of biological process
GO:0051172	0.807	negative regulation of nitrogen compound metabolic process
GO:0051248	0.742	negative regulation of protein metabolic process
GO:0060341	0.638	regulation of cellular localization
GO:0031323	0.535	regulation of cellular metabolic process
GO:0030162	0.494	regulation of proteolysis
GO:0032880	0.481	regulation of protein localization
GO:0051049	0.350	regulation of transport
GO:0010468	0.343	regulation of gene expression
GO:0045861	0.325	negative regulation of proteolysis
GO:0048523	0.319	negative regulation of cellular process
GO:0051223	0.311	regulation of protein transport
GO:0051046	0.300	regulation of secretion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.994	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0005737	0.988	cytoplasm
GO:0005634	0.976	nucleus
GO:0031981	0.918	nuclear lumen
GO:0005783	0.712	endoplasmic reticulum
GO:0071944	0.542	cell periphery
GO:0005886	0.534	plasma membrane
GO:0005829	0.472	cytosol
GO:0032991	0.444	protein-containing complex
GO:0005654	0.398	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]