StarFunc result for job id Q96KJ9

User Input

>input (171 residues)
MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAE
EQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVI
WWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96KJ9	1.000	1.000	1.398E-30	171	1.000	1.000	Q96KJ9.pdb.gz	COX42_HUMAN Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I2 PE=1 SV=2
2	AFDB:Q91W29	0.666	0.663	1.316E-22	172	0.743	0.738	Q91W29.pdb.gz	COX42_MOUSE Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i2 PE=1 SV=1
3	AFDB:Q4VBT9	0.773	0.781	3.655E-16	169	0.421	0.426	Q4VBT9.pdb.gz
4	AFDB:P13073	0.771	0.780	4.479E-16	169	0.474	0.479	P13073.pdb.gz	COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
5	AFDB:P00423	0.752	0.760	9.437E-16	169	0.444	0.450	P00423.pdb.gz	COX41_BOVIN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Bos taurus OX=9913 GN=COX4I1 PE=1 SV=1
6	AFDB:P10888	0.766	0.775	1.623E-15	169	0.433	0.438	P10888.pdb.gz	COX41_RAT Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox4i1 PE=1 SV=1
7	PDB:2y69D	0.738	0.869	3.267E-15	144	0.415	0.493	2y69D.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
8	AFDB:Q9VIQ8	0.695	0.656	6.307E-12	182	0.322	0.302	Q9VIQ8.pdb.gz	Q9VIQ8_DROME Cytochrome c oxidase subunit 4 OS=Drosophila melanogaster OX=7227 GN=COX4 PE=1 SV=1
9	AFDB:Q9U329	0.694	0.679	6.767E-9	175	0.275	0.269	Q9U329.pdb.gz	Q9U329_CAEEL Cytochrome c oxidase subunit 4 OS=Caenorhabditis elegans OX=6239 GN=cox-4 PE=1 SV=1
10	AFDB:O74988	0.359	0.337	2.633E-4	186	0.228	0.210	O74988.pdb.gz	COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox5 PE=1 SV=2
11	AFDB:Q5APK5	0.401	0.413	2.150E-3	165	0.175	0.182	Q5APK5.pdb.gz	Q5APK5_CANAL Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX5 PE=4 SV=1
12	PDB:7apxA	0.159	0.035	4.341	1165	0.088	0.013	7apxA.pdb.gz
13	PDB:7obrx	0.159	0.059	5.692	488	0.111	0.039	7obrx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
14	PDB:5aanA	0.112	0.106	6.091	183	0.018	0.016	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
15	PDB:7ob9M	0.096	0.047	6.518	388	0.094	0.041	7ob9M.pdb.gz	Cryo-EM structures of human RNA polymerase I.
16	PDB:5l3cB	0.133	0.169	6.975	134	0.070	0.090	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
17	PDB:6ig9T	0.127	0.010	7.987	3386	0.088	0.004	6ig9T.pdb.gz
18	PDB:6qw65X	0.157	0.054	7.987	583	0.099	0.029	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7a09N	0.077	0.042	9.146	447	0.082	0.031	7a09N.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
20	PDB:7sszA	0.143	0.077	9.146	362	0.064	0.030	7sszA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96KJ9	1.75e-128	359	171	1.000	1.000	COX42_HUMAN Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I2 PE=1 SV=2
2	Q91W29	1.56e-91	265	172	0.743	0.738	COX42_MOUSE Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i2 PE=1 SV=1
3	Q91Y94	9.86e-91	263	172	0.713	0.709	COX42_RAT Cytochrome c oxidase subunit 4 isoform 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox4i2 PE=2 SV=1
4	P13073	8.80e-53	167	169	0.503	0.509	COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
5	P19783	6.63e-51	162	169	0.474	0.479	COX41_MOUSE Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2
6	Q6TNV0	3.26e-50	160	169	0.468	0.473	Q6TNV0_DANRE Cytochrome c oxidase subunit 4 OS=Danio rerio OX=7955 GN=COX4I1 PE=1 SV=1
7	P00423	4.83e-50	160	169	0.480	0.485	COX41_BOVIN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Bos taurus OX=9913 GN=COX4I1 PE=1 SV=1
8	P10888	9.29e-50	159	169	0.480	0.485	COX41_RAT Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox4i1 PE=1 SV=1
9	Q9VIQ8	6.60e-31	112	182	0.333	0.313	Q9VIQ8_DROME Cytochrome c oxidase subunit 4 OS=Drosophila melanogaster OX=7227 GN=COX4 PE=1 SV=1
10	H3BN72	2.16e-30	109	126	0.339	0.460	H3BN72_HUMAN Cytochrome c oxidase subunit 4 OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
11	H3BNV9	2.96e-30	109	139	0.339	0.417	H3BNV9_HUMAN Cytochrome c oxidase subunit 4 OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
12	Q9U329	8.42e-13	65.1	175	0.187	0.183	Q9U329_CAEEL Cytochrome c oxidase subunit 4 OS=Caenorhabditis elegans OX=6239 GN=cox-4 PE=1 SV=1
13	Q86WV2	2.18e-05	43.1	83	0.152	0.313	Q86WV2_HUMAN COX4I1 protein OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1
14	O74988	6.08e-04	40.8	186	0.181	0.167	COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox5 PE=1 SV=2
15	Q5APK5	0.43	32.3	165	0.158	0.164	Q5APK5_CANAL Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX5 PE=4 SV=1
16	Q03758	4.0	30.4	920	0.117	0.022	BUL2_YEAST Ubiquitin ligase-binding protein BUL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUL2 PE=1 SV=1
17	Q9W266	5.0	30.0	677	0.111	0.028	WDP_DROME Protein windpipe OS=Drosophila melanogaster OX=7227 GN=wdp PE=1 SV=1
18	Q9DA37	5.8	29.6	478	0.094	0.033	SAMD8_MOUSE Sphingomyelin synthase-related protein 1 OS=Mus musculus OX=10090 GN=Samd8 PE=2 SV=1
19	Q5JSC9	5.9	29.3	253	0.088	0.059	Q5JSC9_HUMAN Sterile alpha motif domain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=SAMD8 PE=1 SV=8
20	P93159	7.4	29.3	668	0.099	0.025	ENG1_SOYBN Glucan endo-1,3-beta-D-glucosidase OS=Glycine max OX=3847 GN=GBP PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02936 COX4	3.7e-48	174.5	Cytochrome c oxidase subunit IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317780	0.994	Cytochrome c oxidase subunit 5A, mitochondrial
2	9606.ENSP00000287490	0.988	Cytochrome c oxidase subunit 6A2, mitochondrial
3	9606.ENSP00000268379	0.971	Cytochrome b-c1 complex subunit 2, mitochondrial
4	9606.ENSP00000307786	0.969	Cytochrome c
5	9606.ENSP00000317159	0.965	Cytochrome c1, heme protein, mitochondrial
6	9606.ENSP00000246554	0.960	Cytochrome c oxidase subunit 6B1
7	9606.ENSP00000266544	0.943	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
8	9606.ENSP00000428895	0.943	Cytochrome c oxidase subunit 6C
9	9606.ENSP00000306397	0.939	Cytochrome b-c1 complex subunit Rieske, mitochondrial
10	9606.ENSP00000354499	0.937	Cytochrome c oxidase subunit 1
11	9606.ENSP00000332887	0.933	Cytochrome b-c1 complex subunit 9
12	9606.ENSP00000268668	0.931	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
13	9606.ENSP00000315774	0.927	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
14	9606.ENSP00000215375	0.926	ATP synthase subunit delta, mitochondrial
15	9606.ENSP00000354554	0.922	Cytochrome b
16	9606.ENSP00000258424	0.921	Cytochrome c oxidase subunit 5B, mitochondrial
17	9606.ENSP00000367939	0.916	Cytochrome b-c1 complex subunit 8
18	9606.ENSP00000467266	0.913	Cytochrome c oxidase subunit 6B2
19	9606.ENSP00000253457	0.912	ER membrane protein complex subunit 8
20	9606.ENSP00000229379	0.911	Cytochrome c oxidase subunit 6A1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004129	1.000	cytochrome-c oxidase activity
GO:0005488	0.975	binding
GO:0005515	0.973	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0006091	0.991	generation of precursor metabolites and energy
GO:0006119	0.925	oxidative phosphorylation
GO:0022900	0.903	electron transport chain
GO:0022904	0.874	respiratory electron transport chain
GO:0042775	0.840	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.822	aerobic electron transport chain

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0098800	0.998	inner mitochondrial membrane protein complex
GO:0098803	0.995	respiratory chain complex
GO:0005746	0.992	mitochondrial respirasome
GO:0070069	0.954	cytochrome complex
GO:0045277	0.929	respiratory chain complex IV
GO:0005751	0.847	mitochondrial respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.

[back to server]