StarFunc result for job id Q96KN7

User Input

>input (1286 residues)
MSHLVDPTSGDLPVRDIDAIPLVLPASKGKNMKTQPPLSRMNREELEDSFFRLREDHMLV
KELSWKQQDEIKRLRTTLLRLTAAGRDLRVAEEAAPLSETARRGQKAGWRQRLSMHQRPQ
MHRLQGHFHCVGPASPRRAQPRVQVGHRQLHTAGAPVPEKPKRGPRDRLSYTAPPSFKEH
ATNENRGEVASKPSELVSGSNSIISFSSVISMAKPIGLCMPNSAHIMASNTMQVEEPPKS
PEKMWPKDENFEQRSSLECAQKAAELRASIKEKVELIRLKKLLHERNASLVMTKAQLTEV
QEAYETLLQKNQGILSAAHEALLKQVNELRAELKEESKKAVSLKSQLEDVSILQMTLKEF
QERVEDLEKERKLLNDNYDKLLESMLDSSDSSSQPHWSNELIAEQLQQQVSQLQDQLDAE
LEDKRKVLLELSREKAQNEDLKLEVTNILQKHKQEVELLQNAATISQPPDRQSEPATHPA
VLQENTQIEPSEPKNQEEKKLSQVLNELQVSHAETTLELEKTRDMLILQRKINVCYQEEL
EAMMTKADNDNRDHKEKLERLTRLLDLKNNRIKQLEGILRSHDLPTSEQLKDVAYGTRPL
SLCLETLPAHGDEDKVDISLLHQGENLFELHIHQAFLTSAALAQAGDTQPTTFCTYSFYD
FETHCTPLSVGPQPLYDFTSQYVMETDSLFLHYLQEASARLDIHQAMASEHSTLAAGWIC
FDRVLETVEKVHGLATLIGAGGEEFGVLEYWMRLRFPIKPSLQACNKRKKAQVYLSTDVL
GGRKAQEEEFRSESWEPQNELWIEITKCCGLRSRWLGTQPSPYAVYRFFTFSDHDTAIIP
ASNNPYFRDQARFPVLVTSDLDHYLRREALSIHVFDDEDLEPGSYLGRARVPLLPLAKNE
SIKGDFNLTDPAEKPNGSIQVQLDWKFPYIPPESFLKPEAQTKGKDTKDSSKISSEEEKA
SFPSQDQMASPEVPIEAGQYRSKRKPPHGGERKEKEHQVVSYSRRKHGKRIGVQGKNRME
YLSLNILNGNTPEQVNYTEWKFSETNSFIGDGFKNQHEEEEMTLSHSALKQKEPLHPVND
KESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSLAFYPEAEVMSDENIK
QVYVEYKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQ
DPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPI
GRLKVSLQAAAVLHAIYKEMTEDLFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96KN7	1.000	1.000	0.000	1286	1.000	1.000	Q96KN7.pdb.gz	RPGR1_HUMAN X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Homo sapiens OX=9606 GN=RPGRIP1 PE=1 SV=2
2	AFDB:Q9EPQ2	0.165	0.161	0.000	1331	0.644	0.622	Q9EPQ2.pdb.gz	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
3	AFDB:Q68CZ1	0.217	0.213	3.220E-80	1315	0.315	0.308	Q68CZ1.pdb.gz	FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2
4	AFDB:Q9BHL0	0.095	0.205	1.690E-14	570	0.046	0.104	Q9BHL0.pdb.gz	Q9BHL0_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sas-1 PE=1 SV=2
5	AFDB:Q9UQ26	0.073	0.066	9.800E-10	1411	0.123	0.112	Q9UQ26.pdb.gz	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
6	PDB:6kxkD	0.081	0.169	1.909E-8	553	0.030	0.069	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
7	AFDB:Q8R361	0.095	0.182	2.840E-8	645	0.051	0.102	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
8	PDB:5iz5A	0.083	0.132	1.423E-7	757	0.025	0.042	5iz5A.pdb.gz
9	AFDB:Q9JIS1	0.069	0.059	1.899E-7	1555	0.112	0.093	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
10	AFDB:Q9JIR4	0.072	0.058	2.117E-7	1615	0.105	0.084	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
11	PDB:5iz5B	0.088	0.140	3.044E-7	746	0.025	0.043	5iz5B.pdb.gz
12	PDB:5a52A	0.084	0.608	3.214E-7	154	0.020	0.169	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
13	PDB:4rj9A	0.083	0.562	5.239E-7	161	0.023	0.180	4rj9A.pdb.gz
14	PDB:5ixcA	0.082	0.149	1.005E-6	684	0.022	0.041	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5a50A	0.082	0.548	2.149E-6	165	0.020	0.158	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	AFDB:Q99NE5	0.071	0.063	3.763E-6	1463	0.058	0.051	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
17	PDB:1cjyA	0.086	0.168	6.367E-6	633	0.018	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
18	AFDB:A0A5F8MPU3	0.091	0.054	1.919E-5	2282	0.051	0.029	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
19	PDB:5izrC	0.081	0.152	2.758E-5	659	0.024	0.047	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
20	PDB:3nsjA	0.083	0.194	3.619E-5	530	0.016	0.040	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A160	0.0	1122	1327	0.466	0.451	A0A8I6A160_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=3 SV=1
2	A0A8I6APX2	0.0	796	1123	0.307	0.352	A0A8I6APX2_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=4 SV=1
3	D3Z8G3	0.0	582	1268	0.333	0.338	D3Z8G3_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=2
4	E1BJB4	0.0	621	1270	0.338	0.343	E1BJB4_BOVIN RPGRIP1 like OS=Bos taurus OX=9913 GN=RPGRIP1L PE=1 SV=3
5	F1PKQ6	0.0	1647	1209	0.662	0.704	F1PKQ6_CANLF RPGR-interacting protein 1 OS=Canis lupus familiaris OX=9615 GN=RPGRIP1 PE=2 SV=2
6	Q8CG73	0.0	598	1264	0.334	0.339	FTM_MOUSE Protein fantom OS=Mus musculus OX=10090 GN=Rpgrip1l PE=1 SV=2
7	Q96KN7	0.0	2659	1286	1.000	1.000	RPGR1_HUMAN X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Homo sapiens OX=9606 GN=RPGRIP1 PE=1 SV=2
8	Q9EPQ2	0.0	1122	1331	0.465	0.449	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
9	A0A8I6A999	1.65e-168	535	1193	0.277	0.298	A0A8I6A999_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=1
10	A0A087WX34	8.93e-158	509	1269	0.264	0.267	A0A087WX34_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
11	H3BS47	1.07e-157	508	1253	0.264	0.271	H3BS47_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
12	H3BV03	1.21e-157	509	1281	0.264	0.265	H3BV03_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
13	Q68CZ1	5.56e-157	508	1315	0.264	0.258	FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2
14	E7F4E7	1.89e-142	467	1256	0.265	0.271	E7F4E7_DANRE Protein fantom OS=Danio rerio OX=7955 GN=si:ch1073-301i20.1 PE=3 SV=2
15	A0A8I6GGU8	1.96e-69	234	231	0.101	0.563	A0A8I6GGU8_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=4 SV=1
16	Q4V8G9	4.65e-65	223	245	0.097	0.510	Q4V8G9_RAT RPGR interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rpgrip1 PE=2 SV=1
17	H3BPF5	2.68e-25	111	354	0.085	0.308	H3BPF5_HUMAN RPGRIP1 like (Fragment) OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
18	Q09459	1.93e-08	61.6	1322	0.078	0.076	FTM_CAEEL Protein fantom OS=Caenorhabditis elegans OX=6239 GN=mks-5 PE=2 SV=4
19	Q57YZ5	0.024	41.6	1156	0.017	0.019	Q57YZ5_TRYB2 RPGR-interacting protein 1 first C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.140 PE=3 SV=1
20	Q388V1	0.039	40.8	959	0.054	0.072	Q388V1_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0560 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.04	25.5	C2 domain
2	PF11618 C2-C2_1	4.5e-55	197.0	First C2 domain of RPGR-interacting protein 1
3	PF16897 MMR_HSR1_Xtn	6.6e+02	11.7	C-terminal region of MMR_HSR1 domain
4	PF18111 RPGR1_C	1.3e-67	238.3	Retinitis pigmentosa G-protein regulator interacting C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367766	0.999	X-linked retinitis pigmentosa GTPase regulator
2	9606.ENSP00000367398	0.981	Nephrocystin-4
3	9606.ENSP00000369257	0.951	Protein fantom
4	9606.ENSP00000377176	0.897	Spermatogenesis-associated protein 7
5	9606.ENSP00000370521	0.807	Aryl-hydrocarbon-interacting protein-like 1
6	9606.ENSP00000233027	0.740	Serine/threonine-protein kinase Nek4
7	9606.ENSP00000218249	0.720	Ras-related protein Rab-40A-like
8	9606.ENSP00000311505	0.711	IQ calmodulin-binding motif-containing protein 1
9	9606.ENSP00000314116	0.705	Transmembrane protein 107
10	9606.ENSP00000440638	0.700	Transmembrane protein 216
11	9606.ENSP00000448012	0.694	Centrosomal protein of 290 kDa
12	9606.ENSP00000254854	0.661	Retinal guanylyl cyclase 1
13	9606.ENSP00000480364	0.652	RCC1-like G exchanging factor-like protein
14	9606.ENSP00000446215	0.649	GTP-binding nuclear protein Ran
15	9606.ENSP00000262340	0.632	Retinoid isomerohydrolase
16	9606.ENSP00000376686	0.623	Lebercilin
17	9606.ENSP00000458355	0.610	Dynein heavy chain 2, axonemal
18	9606.ENSP00000229771	0.606	Tubby-related protein 1
19	9606.ENSP00000356370	0.603	Protein crumbs homolog 1
20	9606.ENSP00000283195	0.587	E3 SUMO-protein ligase RanBP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007600	0.989	sensory perception
GO:0065007	0.800	biological regulation
GO:0050953	0.792	sensory perception of light stimulus
GO:0007601	0.775	visual perception
GO:0050789	0.768	regulation of biological process
GO:0009987	0.757	cellular process
GO:0050794	0.696	regulation of cellular process
GO:0050896	0.419	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005856	0.999	cytoskeleton
GO:0005829	0.994	cytosol
GO:0005929	0.989	cilium
GO:0035869	0.895	ciliary transition zone
GO:0043231	0.868	intracellular membrane-bounded organelle
GO:0016020	0.844	membrane
GO:0005634	0.748	nucleus
GO:0097014	0.746	ciliary plasm
GO:0015630	0.716	microtubule cytoskeleton
GO:0005930	0.704	axoneme
GO:0005815	0.608	microtubule organizing center
GO:0070013	0.365	intracellular organelle lumen
GO:0031981	0.331	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]