StarFunc result for job id Q96KP6

User Input

>input (325 residues)
MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQ
FRSMKELYERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRLQRE
EKEKERLNEELHELKEENKLLKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDC
LRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLN
RLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQW
YALDQLPPDVQHKANGLSSVKKVHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96KP6	1.000	1.000	7.029E-44	325	1.000	1.000	Q96KP6.pdb.gz	TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapiens OX=9606 GN=TNIP3 PE=1 SV=2
2	AFDB:Q940C2	0.285	0.269	6.944E-2	360	0.182	0.164	Q940C2.pdb.gz	Q940C2_ARATH AT5g52550/F6N7_3 OS=Arabidopsis thaliana OX=3702 GN=At5g52550 PE=1 SV=1
3	AFDB:Q6NRV0	0.207	0.155	9.369E-2	464	0.175	0.123	Q6NRV0.pdb.gz	TRAIP_XENLA E3 ubiquitin-protein ligase TRAIP OS=Xenopus laevis OX=8355 GN=traip PE=1 SV=2
4	AFDB:Q9VM65	0.153	0.158	2.882E-1	315	0.114	0.117	Q9VM65.pdb.gz	FGOP2_DROME FGFR1 oncogene partner 2 homolog OS=Drosophila melanogaster OX=7227 GN=Fgop2 PE=2 SV=1
5	AFDB:F1RCU7	0.121	0.045	3.106E-1	1077	0.080	0.024	F1RCU7.pdb.gz
6	AFDB:Q8VIG6	0.260	0.185	4.517E-1	470	0.148	0.102	Q8VIG6.pdb.gz	TRAIP_MOUSE E3 ubiquitin-protein ligase TRAIP OS=Mus musculus OX=10090 GN=Traip PE=1 SV=2
7	AFDB:E7EY31	0.259	0.097	8.223E-1	1022	0.178	0.057	E7EY31.pdb.gz	E7EY31_DANRE Coiled-coil domain-containing 57 OS=Danio rerio OX=7955 GN=ccdc57 PE=4 SV=1
8	AFDB:Q9VIV8	0.207	0.168	1.030	454	0.160	0.115	Q9VIV8.pdb.gz	Q9VIV8_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13084 PE=4 SV=1
9	AFDB:Q86X02	0.234	0.172	1.110	465	0.178	0.125	Q86X02.pdb.gz	CDR2L_HUMAN Cerebellar degeneration-related protein 2-like OS=Homo sapiens OX=9606 GN=CDR2L PE=1 SV=2
10	AFDB:A0A0S4XR43	0.219	0.066	1.196	1215	0.074	0.020	A0A0S4XR43.pdb.gz	A0A0S4XR43_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
11	PDB:4n78F	0.121	0.219	5.917	156	0.065	0.135	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:7c4jB	0.163	0.139	9.995	395	0.083	0.068	7c4jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96KP6	0.0	662	325	1.000	1.000	TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapiens OX=9606 GN=TNIP3 PE=1 SV=2
2	Q15025	9.31e-42	155	636	0.295	0.151	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
3	A0A0A0MRZ4	9.73e-42	155	619	0.295	0.155	A0A0A0MRZ4_HUMAN TNFAIP3 interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
4	Q9WUU8	1.47e-41	154	647	0.329	0.165	TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus musculus OX=10090 GN=Tnip1 PE=1 SV=1
5	F1QHG7	0.013	39.7	602	0.068	0.037	F1QHG7_DANRE Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma (Fragment) OS=Danio rerio OX=7955 GN=fj33c07 PE=1 SV=1
6	Q58EN3	0.014	39.7	586	0.068	0.038	Q58EN3_DANRE Ikbkg protein OS=Danio rerio OX=7955 GN=wu:fj33c07 PE=1 SV=1
7	A0A1D8PN92	0.015	39.7	1948	0.132	0.022	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
8	P42566	0.044	38.1	896	0.074	0.027	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
9	O88522	0.11	36.6	412	0.065	0.051	NEMO_MOUSE NF-kappa-B essential modulator OS=Mus musculus OX=10090 GN=Ikbkg PE=1 SV=2
10	Q8NFZ5	0.18	35.8	429	0.111	0.084	TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
11	Q5RI56	0.25	35.4	517	0.098	0.062	OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn PE=2 SV=2
12	Q96CV9	0.97	33.9	577	0.089	0.050	OPTN_HUMAN Optineurin OS=Homo sapiens OX=9606 GN=OPTN PE=1 SV=3
13	Q8K3K8	1.2	33.5	584	0.092	0.051	OPTN_MOUSE Optineurin OS=Mus musculus OX=10090 GN=Optn PE=1 SV=1
14	Q8R5M4	1.8	32.7	585	0.043	0.024	OPTN_RAT Optineurin OS=Rattus norvegicus OX=10116 GN=Optn PE=1 SV=3
15	A0A087X1B1	2.5	32.3	418	0.120	0.093	A0A087X1B1_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
16	C9J2V2	2.5	32.3	407	0.120	0.096	C9J2V2_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2
17	Q9Y6K9	2.6	32.3	419	0.120	0.093	NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2
18	A0A087WUW6	2.9	32.0	412	0.120	0.095	A0A087WUW6_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
19	A0A087X0G7	2.9	32.0	411	0.120	0.095	A0A087X0G7_HUMAN Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=1
20	Q8TDM6	3.9	32.0	1919	0.055	0.009	DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16516 CC2-LZ	5.1e-11	54.2	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
2	PF15011 CK2S	4	18.8	Casein Kinase 2 substrate
3	PF09744 Jnk-SapK_ap_N	1.1e+02	14.6	JNK_SAPK-associated protein-1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008967736.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008951293.1	0.786	TNF alpha induced protein 3
2	9597.XP_008972951.1	0.674	E2F-associated phosphoprotein
3	9597.XP_003826885.1	0.663	Zinc finger CCHC-type containing 4
4	9597.XP_008950993.1	0.661	GC-rich promoter binding protein 1
5	9597.XP_008952370.1	0.648	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
6	9597.XP_003804997.1	0.606	Belongs to the EMC4 family.
7	9597.XP_003818668.1	0.591	CCR4-NOT transcription complex subunit 9
8	9597.XP_008959226.1	0.583	Belongs to the GST superfamily.
9	9597.XP_008963744.1	0.564	TNFAIP3 interacting protein 2
10	9597.XP_008954325.1	0.552	Myeloid leukemia factor 1
11	9597.XP_003805101.1	0.523	Secretory carrier membrane protein 1
12	9597.XP_008964748.1	0.502	Enhancer of zeste 1 polycomb repressive complex 2 subunit
13	9597.XP_003808712.1	0.501	C-type lectin domain family 4 member D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031593	1.000	polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.989	regulation of biological process
GO:0007165	0.978	signal transduction
GO:0043122	0.972	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0002253	0.967	activation of immune response
GO:0045089	0.965	positive regulation of innate immune response
GO:0048523	0.956	negative regulation of cellular process
GO:0009607	0.952	response to biotic stimulus
GO:0010033	0.952	response to organic substance
GO:0009605	0.951	response to external stimulus
GO:0009968	0.943	negative regulation of signal transduction
GO:0002221	0.929	pattern recognition receptor signaling pathway
GO:0071219	0.927	cellular response to molecule of bacterial origin
GO:0071310	0.923	cellular response to organic substance
GO:1902532	0.923	negative regulation of intracellular signal transduction
GO:0043124	0.910	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0071222	0.908	cellular response to lipopolysaccharide
GO:0007166	0.892	cell surface receptor signaling pathway
GO:0002224	0.821	toll-like receptor signaling pathway
GO:0002429	0.802	immune response-activating cell surface receptor signaling pathway
GO:0002220	0.754	innate immune response activating cell surface receptor signaling pathway
GO:0002752	0.327	cell surface pattern recognition receptor signaling pathway
GO:0019222	0.300	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0070013	0.499	intracellular organelle lumen
GO:0005634	0.464	nucleus
GO:0031981	0.449	nuclear lumen
GO:0005654	0.398	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]