StarFunc result for job id Q96KQ4

User Input

>input (1090 residues)
MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDH
MMYEHLQKWGPRREEVKFFLRHEDSPTENSEQGGRQTQEQRTQRNVINVPGEKRTENGVG
NPRVELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLK
ERVEAQENKLKKIRAMRGQVDYSKIMNGNLSAEIERFSAMFQEKKQEVQTAILRVDQLSQ
QLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKELLNKRN
MEVAMMDKRISELRERLYGKKIQLNRVNGTSSPQSPLSTSGRVAAVGPYIQVPSAGSFPV
LGDPIKPQSLSIASNAAHGRSKSANDGNWPTLKQNSSSSVKPVQVAGADWKDPSVEGSVK
QGTVSSQPVPFSALGPTEKPGIEIGKVPPPIPGVGKQLPPSYGTYPSPTPLGPGSTSSLE
RRKEGSLPRPSAGLPSRQRPTLLPATGSTPQPGSSQQIQQRISVPPSPTYPPAGPPAFPA
GDSKPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAAHSA
LNKSVKAVYGKPVLPSGSTSPSPLPFLHGSLSTGTPQPQPPSESTEKEPEQDGPAAPADG
STVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPGGP
NIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAP
LPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEA
PSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGE
FDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHC
AASCNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMN
KGVAYALWDYEAQNSDELSFHEGDALTILRRKDESETEWWWARLGDREGYVPKNLLGLYP
RIKPRQRTLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A6A8	0.222	0.229	0.000	1042	0.858	0.897	D4A6A8.pdb.gz	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
2	AFDB:Q96KQ4	1.000	1.000	0.000	1090	1.000	1.000	Q96KQ4.pdb.gz	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
3	AFDB:Q13625	0.269	0.262	3.960E-84	1128	0.495	0.479	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
4	AFDB:F1QWN1	0.222	0.227	2.833E-83	1063	0.470	0.482	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
5	AFDB:F1M5H6	0.361	0.351	3.571E-83	1128	0.494	0.477	F1M5H6.pdb.gz	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
6	AFDB:F1R419	0.288	0.295	1.468E-80	1060	0.468	0.481	F1R419.pdb.gz	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
7	PDB:8cs9A	0.100	0.134	2.201E-7	796	0.035	0.048	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
8	PDB:6jd6B	0.109	0.580	2.501E-6	192	0.032	0.182	6jd6B.pdb.gz
9	PDB:5vkqA	0.103	0.076	3.341E-6	1499	0.038	0.027	5vkqA.pdb.gz
10	PDB:2dvwA	0.105	0.479	5.009E-6	229	0.034	0.162	2dvwA.pdb.gz
11	PDB:7df7B	0.099	0.816	5.308E-6	119	0.029	0.269	7df7B.pdb.gz
12	PDB:4oauC	0.105	0.163	5.624E-6	692	0.034	0.053	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:6mwqA	0.102	0.222	5.624E-6	493	0.036	0.079	6mwqA.pdb.gz
14	PDB:6v9hC	0.109	0.414	7.511E-6	270	0.028	0.115	6v9hC.pdb.gz
15	AFDB:A0A140LI88	0.108	0.064	8.676E-6	1857	0.103	0.060	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
16	AFDB:X1WE18	0.091	0.091	1.951E-5	1085	0.127	0.127	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
17	PDB:1wg0A	0.103	0.444	2.009E-5	243	0.032	0.144	1wg0A.pdb.gz
18	PDB:3ehqA	0.100	0.572	3.012E-5	182	0.023	0.137	3ehqA.pdb.gz
19	AFDB:Q9H9B1	0.114	0.096	4.386E-5	1298	0.113	0.095	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
20	AFDB:M9MRX0	0.098	0.107	1.317E-4	989	0.084	0.093	M9MRX0.pdb.gz	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KB61	0.0	1966	1088	0.919	0.921	A0A0G2KB61_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=2
2	A0A3B3ISJ2	0.0	2189	1075	0.986	1.000	A0A3B3ISJ2_HUMAN Protein phosphatase 1 regulatory subunit 13B (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=1
3	A0A8I6A8S6	0.0	1948	1123	0.918	0.891	A0A8I6A8S6_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=4 SV=1
4	D4A6A8	0.0	1816	1042	0.858	0.897	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
5	Q05BL1	0.0	765	1048	0.461	0.480	Q05BL1_HUMAN TP53BP2 protein OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=1
6	Q13625	0.0	892	1128	0.515	0.497	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
7	Q96KQ4	0.0	2229	1090	1.000	1.000	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
8	Q1LXN7	1.07e-170	531	1060	0.273	0.281	Q1LXN7_DANRE Tumor protein p53 binding protein, 2 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=1
9	F1QWN1	1.51e-170	531	1063	0.273	0.280	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
10	Q8CG79	3.34e-156	495	1128	0.325	0.314	ASPP2_MOUSE Apoptosis-stimulating of p53 protein 2 OS=Mus musculus OX=10090 GN=Tp53bp2 PE=1 SV=3
11	A0A8I6A5P5	1.87e-125	411	1040	0.164	0.172	A0A8I6A5P5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
12	F1M5H6	2.70e-124	410	1128	0.164	0.159	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
13	A0A8I6ANU5	2.75e-124	410	1119	0.164	0.160	A0A8I6ANU5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=4 SV=1
14	F1R419	1.27e-121	401	1060	0.160	0.164	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
15	Q6NSN9	2.31e-120	398	1060	0.159	0.163	Q6NSN9_DANRE Apoptosis-stimulating of p53 protein 2 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
16	A0A8I6AMB5	1.36e-114	384	1146	0.153	0.146	A0A8I6AMB5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
17	Q9W2J2	1.79e-87	306	1020	0.125	0.133	Q9W2J2_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform A OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=3
18	Q86PC3	2.01e-87	306	1020	0.125	0.133	Q86PC3_DROME RE13301p OS=Drosophila melanogaster OX=7227 GN=ASPP PE=2 SV=1
19	A0A0B4KF17	2.40e-87	306	1046	0.125	0.130	A0A0B4KF17_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform C OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1
20	Q86BG1	5.50e-87	306	1069	0.125	0.127	Q86BG1_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform B OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	6.4e-09	47.1	Ankyrin repeat
2	PF12796 Ank_2	2e-12	58.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.2e-08	45.4	Ankyrin repeat
4	PF13637 Ank_4	8.1e-11	53.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.00022	32.7	Ankyrin repeats (many copies)
6	PF00018 SH3_1	1.9e-09	48.3	SH3 domain
7	PF07653 SH3_2	2.6e-05	35.2	Variant SH3 domain
8	PF14604 SH3_9	2e-07	42.1	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000202556

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.990	Cellular tumor antigen p53
2	9606.ENSP00000384491	0.952	Ras association domain family member 8
3	9606.ENSP00000326031	0.932	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
4	9606.ENSP00000341779	0.929	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
5	9606.ENSP00000238721	0.918	Quinone oxidoreductase PIG3
6	9606.ENSP00000347979	0.916	Tumor necrosis factor receptor superfamily member 6
7	9606.ENSP00000404503	0.915	Bcl-2-binding component 3
8	9606.ENSP00000293288	0.900	Apoptosis regulator BAX
9	9606.ENSP00000380713	0.890	Ras association domain-containing protein 7
10	9606.ENSP00000264731	0.843	Tumor protein 63
11	9606.ENSP00000372035	0.815	Serine/threonine-protein kinase LATS2
12	9606.ENSP00000299163	0.800	Hypoxia-inducible factor 1-alpha inhibitor
13	9606.ENSP00000367545	0.781	Tumor protein p73
14	9606.ENSP00000437550	0.717	Serine/threonine-protein kinase LATS1
15	9606.ENSP00000383402	0.705	Serine/threonine-protein phosphatase 4 regulatory subunit 1
16	9606.ENSP00000341957	0.673	Apoptosis-stimulating of p53 protein 2
17	9606.ENSP00000378769	0.613	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
18	9606.ENSP00000234038	0.583	Protein phosphatase 1 regulatory subunit 7
19	9606.ENSP00000322457	0.576	E3 ubiquitin-protein ligase SIAH2
20	9606.ENSP00000323967	0.559	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010941	0.996	regulation of cell death
GO:0010942	0.990	positive regulation of cell death
GO:1901214	0.982	regulation of neuron death
GO:1901216	0.949	positive regulation of neuron death
GO:0009987	0.893	cellular process
GO:0050896	0.828	response to stimulus
GO:0051716	0.772	cellular response to stimulus
GO:0007154	0.711	cell communication
GO:0007165	0.683	signal transduction
GO:0035556	0.648	intracellular signal transduction
GO:0048523	0.642	negative regulation of cellular process
GO:0006915	0.574	apoptotic process
GO:0051726	0.479	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0005829	0.985	cytosol
GO:0005886	0.926	plasma membrane
GO:0048471	0.488	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]