StarFunc result for job id Q96KQ7

User Input

>input (1210 residues)
MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLE
PAGPSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSP
SKGGSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKV
HRARKTMSKPGNGQPPVPEKRPPEIQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEEL
GSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSE
EEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRR
KREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGF
EELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVL
CETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDA
SEAQEVTIPRGDGVTPPAGTAAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLA
DTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQ
GELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRT
PLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNA
QDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNA
RCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFA
LQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETS
TMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQA
CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVR
EDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFS
SRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLP
ELGSLPPVNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K889	0.237	0.223	0.000	1289	0.475	0.446	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
2	AFDB:A2ABF9	0.459	0.440	0.000	1267	0.968	0.924	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
3	AFDB:Q9H9B1	0.241	0.225	0.000	1298	0.485	0.452	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
4	AFDB:M9PGH7	0.222	0.170	1.028E-66	1657	0.289	0.211	M9PGH7.pdb.gz	M9PGH7_DROME G9a, isoform B OS=Drosophila melanogaster OX=7227 GN=G9a PE=1 SV=1
5	PDB:8cs9A	0.147	0.207	3.131E-18	796	0.064	0.097	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	PDB:2dvwA	0.170	0.835	5.317E-16	229	0.050	0.266	2dvwA.pdb.gz
7	PDB:1pegA	0.177	0.759	1.142E-15	266	0.072	0.327	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
8	PDB:4oauC	0.200	0.342	8.621E-15	692	0.058	0.101	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
9	PDB:6v9hC	0.175	0.744	4.202E-14	270	0.050	0.222	6v9hC.pdb.gz
10	PDB:5vkqA	0.192	0.156	1.476E-13	1499	0.056	0.045	5vkqA.pdb.gz
11	PDB:1wg0A	0.175	0.836	2.164E-13	243	0.050	0.247	1wg0A.pdb.gz
12	PDB:6jd6B	0.124	0.737	2.247E-11	192	0.042	0.266	6jd6B.pdb.gz
13	PDB:7td5A	0.122	0.279	1.520E-10	497	0.064	0.155	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
14	PDB:6mwqA	0.129	0.311	1.696E-10	493	0.052	0.128	6mwqA.pdb.gz
15	AFDB:Q9VYD1	0.161	0.090	8.843E-10	2313	0.153	0.080	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
16	AFDB:O88491	0.157	0.077	1.703E-9	2588	0.160	0.075	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
17	AFDB:Q54HC6	0.161	0.136	1.799E-9	1460	0.125	0.103	Q54HC6.pdb.gz	ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum OX=44689 GN=arkA PE=1 SV=1
18	AFDB:Q2LAE1	0.161	0.113	2.496E-9	1759	0.140	0.097	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
19	AFDB:Q8IE95	0.152	0.076	1.091E-8	2548	0.132	0.063	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1
20	AFDB:E9Q5F9	0.149	0.074	1.422E-7	2537	0.141	0.067	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RCN9	0.0	2495	1210	1.000	1.000	A0A024RCN9_HUMAN EHMT2 OS=Homo sapiens OX=9606 PE=4 SV=1
2	A0A0G2JTA5	0.0	2142	1172	0.911	0.940	A0A0G2JTA5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
3	A0A0G2JZM5	0.0	2227	1206	0.939	0.942	A0A0G2JZM5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
4	A0A0G2K889	0.0	1072	1302	0.469	0.436	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
5	A0A1B0GU48	0.0	608	981	0.240	0.297	A0A1B0GU48_HUMAN Euchromatic histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
6	A0A1B0GV09	0.0	1075	1267	0.431	0.411	A0A1B0GV09_HUMAN Euchromatic histone lysine methyltransferase 1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
7	A0A8I6AB09	0.0	1082	1302	0.432	0.402	A0A8I6AB09_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
8	A0A8I6ABS0	0.0	1058	1243	0.418	0.407	A0A8I6ABS0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
9	A0A8I6ANQ0	0.0	1075	1276	0.469	0.445	A0A8I6ANQ0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
10	A0A8J8XWH8	0.0	2141	1241	0.912	0.890	A0A8J8XWH8_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
11	A2ABF8	0.0	2382	1233	0.960	0.942	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
12	A2ABF9	0.0	2465	1267	0.988	0.944	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
13	A8TT22	0.0	1224	1173	0.545	0.562	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
14	D4A005	0.0	1072	1285	0.469	0.442	D4A005_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=4
15	Q5DW34	0.0	1086	1296	0.440	0.410	EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus OX=10090 GN=Ehmt1 PE=1 SV=2
16	Q6MG72	0.0	2236	1263	0.944	0.904	Q6MG72_RAT HLA-B associated transcript 8, rat orthologue OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
17	Q96KQ7	0.0	2495	1210	1.000	1.000	EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3
18	Q9H9B1	0.0	1074	1298	0.431	0.401	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
19	Q9Z148	0.0	2229	1263	0.940	0.900	EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus OX=10090 GN=Ehmt2 PE=1 SV=2
20	Q95RU8	1.54e-135	454	1637	0.234	0.173	Q95RU8_DROME G9a, isoform A OS=Drosophila melanogaster OX=7227 GN=G9a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e-33	125.0	Ankyrin repeat
2	PF12796 Ank_2	3.1e-36	135.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.2e-22	88.3	Ankyrin repeat
4	PF13637 Ank_4	3.9e-29	111.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9.6e-28	107.2	Ankyrin repeats (many copies)
6	PF02724 CDC45	0.73	19.7	CDC45-like protein
7	PF03985 Paf1	1e+02	13.3	Paf1
8	PF05033 Pre-SET	5.4e-12	57.7	Pre-SET motif
9	PF03247 Prothymosin	6.8e+02	11.9	Prothymosin/parathymosin family
10	PF00856 SET	2.1e-20	85.2	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000018412

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000022240	0.990	Euchromatic histone-lysine N-methyltransferase 1
2	9601.ENSPPYP00000019856	0.987	Chromobox protein homolog 3
3	9601.ENSPPYP00000010840	0.949	Uncharacterized protein
4	9601.ENSPPYP00000001838	0.911	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is rel [...]
5	9601.ENSPPYP00000001348	0.890	Zinc finger protein 644
6	9601.ENSPPYP00000005247	0.885	Chromobox homolog 5
7	9601.ENSPPYP00000018112	0.885	Chromodomain protein, Y-like
8	9601.ENSPPYP00000010706	0.873	DNA (cytosine-5-)-methyltransferase 1
9	9601.ENSPPYP00000018964	0.859	Histone deacetylase 2
10	9601.ENSPPYP00000010564	0.854	Ubiquitin-like with PHD and ring finger domains 1
11	9601.ENSPPYP00000018898	0.840	PR domain containing 1, with ZNF domain
12	9601.ENSPPYP00000001074	0.832	Belongs to the histone H3 family.
13	9601.ENSPPYP00000022371	0.832	annotation not available
14	9601.ENSPPYP00000012428	0.818	Snail family zinc finger 1
15	9601.ENSPPYP00000009971	0.800	annotation not available
16	9601.ENSPPYP00000016983	0.800	annotation not available
17	9601.ENSPPYP00000014060	0.798	DNA (cytosine-5-)-methyltransferase 3 alpha
18	9601.ENSPPYP00000013903	0.792	Calmodulin-lysine N-methyltransferase
19	9601.ENSPPYP00000008923	0.789	Cellular tumor antigen p53
20	9601.ENSPPYP00000008555	0.780	Chromodomain protein, Y-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.659	catalytic activity
GO:0008168	0.456	methyltransferase activity
GO:0016279	0.450	protein-lysine N-methyltransferase activity
GO:0042054	0.434	histone methyltransferase activity
GO:0018024	0.421	histone lysine N-methyltransferase activity
GO:0003682	0.420	chromatin binding
GO:0019904	0.407	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0009987	0.988	cellular process
GO:0042221	0.973	response to chemical
GO:0032501	0.968	multicellular organismal process
GO:0051052	0.966	regulation of DNA metabolic process
GO:0009605	0.933	response to external stimulus
GO:0051716	0.924	cellular response to stimulus
GO:0071704	0.909	organic substance metabolic process
GO:0044238	0.903	primary metabolic process
GO:0044237	0.901	cellular metabolic process
GO:0009991	0.898	response to extracellular stimulus
GO:0031060	0.894	regulation of histone methylation
GO:0006807	0.886	nitrogen compound metabolic process
GO:0010468	0.878	regulation of gene expression
GO:0031326	0.875	regulation of cellular biosynthetic process
GO:0044030	0.872	regulation of DNA methylation
GO:0010556	0.865	regulation of macromolecule biosynthetic process
GO:0051252	0.865	regulation of RNA metabolic process
GO:0048519	0.864	negative regulation of biological process
GO:0043170	0.863	macromolecule metabolic process
GO:2001141	0.858	regulation of RNA biosynthetic process
GO:0044260	0.849	cellular macromolecule metabolic process
GO:0006355	0.825	regulation of DNA-templated transcription
GO:0046677	0.799	response to antibiotic
GO:0031667	0.798	response to nutrient levels
GO:0048523	0.794	negative regulation of cellular process
GO:0009892	0.762	negative regulation of metabolic process
GO:0009636	0.750	response to toxic substance
GO:0007610	0.717	behavior
GO:1901564	0.711	organonitrogen compound metabolic process
GO:0010605	0.696	negative regulation of macromolecule metabolic process
GO:0051172	0.686	negative regulation of nitrogen compound metabolic process
GO:0010033	0.677	response to organic substance
GO:0031324	0.677	negative regulation of cellular metabolic process
GO:0070887	0.675	cellular response to chemical stimulus
GO:0007613	0.646	memory
GO:0019538	0.640	protein metabolic process
GO:0045934	0.616	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.615	negative regulation of biosynthetic process
GO:0043412	0.612	macromolecule modification
GO:0036211	0.568	protein modification process
GO:0031327	0.560	negative regulation of cellular biosynthetic process
GO:0010558	0.559	negative regulation of macromolecule biosynthetic process
GO:0051253	0.548	negative regulation of RNA metabolic process
GO:1902679	0.539	negative regulation of RNA biosynthetic process
GO:0016043	0.538	cellular component organization
GO:1903507	0.534	negative regulation of nucleic acid-templated transcription
GO:1901700	0.496	response to oxygen-containing compound
GO:0007616	0.495	long-term memory
GO:0045892	0.490	negative regulation of DNA-templated transcription
GO:0006357	0.415	regulation of transcription by RNA polymerase II
GO:0048518	0.410	positive regulation of biological process
GO:0006950	0.381	response to stress
GO:0016570	0.368	histone modification
GO:0048522	0.352	positive regulation of cellular process
GO:0009893	0.347	positive regulation of metabolic process
GO:0032502	0.333	developmental process
GO:0071466	0.324	cellular response to xenobiotic stimulus
GO:0051173	0.318	positive regulation of nitrogen compound metabolic process
GO:0031325	0.306	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:0000785	0.875	chromatin
GO:0016604	0.754	nuclear body
GO:0016607	0.558	nuclear speck
GO:0032991	0.480	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.456	Methyltransferases.
RHEA:51736	0.450	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]