StarFunc result for job id Q96KS0

User Input

>input (407 residues)
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91YE3	0.535	0.545	4.025E-38	400	0.447	0.455	Q91YE3.pdb.gz	EGLN1_MOUSE Egl nine homolog 1 OS=Mus musculus OX=10090 GN=Egln1 PE=1 SV=2
2	AFDB:Q9GZT9	0.535	0.512	6.385E-38	426	0.450	0.430	Q9GZT9.pdb.gz	EGLN1_HUMAN Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1
3	AFDB:Q8SX21	0.524	0.447	2.781E-30	478	0.297	0.253	Q8SX21.pdb.gz	Q8SX21_DROME HIF prolyl hydroxylase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
4	AFDB:G5EBV0	0.518	0.297	6.288E-28	723	0.285	0.160	G5EBV0.pdb.gz	EGL9_CAEEL Hypoxia-inducible factor prolyl hydroxylase OS=Caenorhabditis elegans OX=6239 GN=egl-9 PE=1 SV=1
5	AFDB:F8W1G2	0.279	0.782	7.332E-19	145	0.206	0.579	F8W1G2.pdb.gz	F8W1G2_HUMAN Egl-9 family hypoxia inducible factor 3 OS=Homo sapiens OX=9606 GN=EGLN3 PE=1 SV=1
6	PDB:4nhyA	0.347	0.310	1.057E-6	461	0.096	0.085	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
7	PDB:5gjaA	0.310	0.406	1.332E-6	299	0.069	0.094	5gjaA.pdb.gz	Pyrazinamide and derivatives block ethylene biosynthesis by inhibiting ACC oxidase.
8	PDB:3kt4A	0.350	0.264	3.351E-6	563	0.101	0.073	3kt4A.pdb.gz	Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
9	PDB:5o7yA	0.345	0.387	3.550E-6	358	0.071	0.081	5o7yA.pdb.gz
10	PDB:4qkbA	0.322	0.631	4.471E-6	190	0.074	0.158	4qkbA.pdb.gz	The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
11	PDB:7etlA	0.337	0.450	4.736E-6	294	0.069	0.095	7etlA.pdb.gz	Structural Insight into the Catalytic Mechanism of the Endoperoxide Synthase FtmOx1.
12	PDB:3mguA	0.344	0.272	8.431E-6	533	0.076	0.058	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
13	PDB:3obzA	0.321	0.434	9.462E-6	290	0.093	0.131	3obzA.pdb.gz	Crystal Structure of Human PHYHD1, a Non-Heme Fe(II) and 2-Oxoglutarate Dependent Oxygenase Related to Phytanoyl-CoA Hydroxylase
14	PDB:6ku3B	0.313	0.384	1.590E-5	318	0.074	0.094	6ku3B.pdb.gz	A common allosteric mechanism regulates homeostatic inactivation of auxin and gibberellin.
15	PDB:7ekdA	0.297	0.341	2.831E-5	343	0.091	0.108	7ekdA.pdb.gz	Evolutionary alterations in gene expression and enzymatic activities of gibberellin 3-oxidase 1 in Oryza.
16	AFDB:Q9USR9	0.191	0.126	4.947E-3	643	0.120	0.076	Q9USR9.pdb.gz	CENPC_SCHPO Inner kinetochore subunit cnp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp3 PE=1 SV=2
17	AFDB:Q03188	0.152	0.072	3.515E-2	943	0.118	0.051	Q03188.pdb.gz	CENPC_HUMAN Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC PE=1 SV=2
18	AFDB:A0A0B4KFS5	0.282	0.126	1.575E-1	991	0.066	0.027	A0A0B4KFS5.pdb.gz	A0A0B4KFS5_DROME Aspartyl beta-hydroxylase, isoform L OS=Drosophila melanogaster OX=7227 GN=Asph PE=1 SV=1
19	AFDB:F4JA39	0.070	0.055	2.646E-1	558	0.091	0.066	F4JA39.pdb.gz	F4JA39_ARATH SLH domain protein OS=Arabidopsis thaliana OX=3702 GN=At3g25680 PE=1 SV=1
20	AFDB:Q8T0L3	0.079	0.036	4.446E-1	1191	0.143	0.049	Q8T0L3.pdb.gz	Q8T0L3_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6AYU4	0.0	721	415	0.904	0.887	EGLN2_RAT Prolyl hydroxylase EGLN2 OS=Rattus norvegicus OX=10116 GN=Egln2 PE=1 SV=1
2	Q96KS0	0.0	828	407	1.000	1.000	EGLN2_HUMAN Prolyl hydroxylase EGLN2 OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
3	Q9GZT9	5.58e-113	339	426	0.378	0.362	EGLN1_HUMAN Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1
4	P59722	7.22e-113	335	338	0.396	0.476	EGLN1_RAT Egl nine homolog 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Egln1 PE=2 SV=2
5	Q91YE3	1.31e-111	334	400	0.376	0.383	EGLN1_MOUSE Egl nine homolog 1 OS=Mus musculus OX=10090 GN=Egln1 PE=1 SV=2
6	Q91UZ4	6.24e-101	301	239	0.329	0.561	EGLN3_MOUSE Prolyl hydroxylase EGLN3 OS=Mus musculus OX=10090 GN=Egln3 PE=1 SV=1
7	Q9H6Z9	1.93e-100	300	239	0.327	0.556	EGLN3_HUMAN Prolyl hydroxylase EGLN3 OS=Homo sapiens OX=9606 GN=EGLN3 PE=1 SV=1
8	Q62630	1.46e-99	298	239	0.327	0.556	EGLN3_RAT Prolyl hydroxylase EGLN3 OS=Rattus norvegicus OX=10116 GN=Egln3 PE=1 SV=2
9	M0R0Z6	3.72e-92	275	139	0.342	1.000	M0R0Z6_HUMAN Egl-9 family hypoxia inducible factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
10	Q9VN98	5.61e-72	230	325	0.278	0.348	Q9VN98_DROME GH23732p OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
11	Q8I0C2	1.08e-71	228	278	0.275	0.403	Q8I0C2_DROME HIF prolyl hydroxylase, isoform B OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
12	Q8SX21	2.12e-70	231	478	0.297	0.253	Q8SX21_DROME HIF prolyl hydroxylase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hph PE=2 SV=1
13	F8W1G2	1.32e-63	202	145	0.209	0.586	F8W1G2_HUMAN Egl-9 family hypoxia inducible factor 3 OS=Homo sapiens OX=9606 GN=EGLN3 PE=1 SV=1
14	M0R110	5.61e-63	199	101	0.248	1.000	M0R110_HUMAN Egl-9 family hypoxia inducible factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
15	M0QXR0	4.38e-58	186	94	0.231	1.000	M0QXR0_HUMAN Egl-9 family hypoxia inducible factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
16	G5EBV0	1.43e-53	191	723	0.226	0.127	EGL9_CAEEL Hypoxia-inducible factor prolyl hydroxylase OS=Caenorhabditis elegans OX=6239 GN=egl-9 PE=1 SV=1
17	M0R035	3.73e-53	173	87	0.214	1.000	M0R035_HUMAN Egl-9 family hypoxia inducible factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=8
18	M0QXM8	5.05e-45	152	77	0.189	1.000	M0QXM8_HUMAN Egl-9 family hypoxia inducible factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
19	M0R1W4	1.15e-41	143	72	0.177	1.000	M0R1W4_HUMAN Egl-9 family hypoxia inducible factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=EGLN2 PE=1 SV=1
20	Q86KR9	2.85e-08	57.0	284	0.113	0.162	P4HA_DICDI Prolyl 4-hydroxylase subunit alpha OS=Dictyostelium discoideum OX=44689 GN=phyA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13640 2OG-FeII_Oxy_3	6.2e-15	67.2	2OG-Fe(II) oxygenase superfamily
2	PF13661 2OG-FeII_Oxy_4	9.3e-06	37.4	2OG-Fe(II) oxygenase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437955	0.999	Hypoxia-inducible factor 1-alpha
2	9606.ENSP00000263734	0.991	Endothelial PAS domain-containing protein 1
3	9606.ENSP00000366898	0.967	Hypoxia-inducible factor 3-alpha
4	9606.ENSP00000476960	0.959	Histone cluster 2 H3 pseudogene 2
5	9606.ENSP00000291582	0.935	Autoimmune regulator
6	9606.ENSP00000318165	0.929	Protein OS-9
7	9606.ENSP00000250457	0.928	Egl nine homolog 3
8	9606.ENSP00000355601	0.908	Egl nine homolog 1
9	9606.ENSP00000256474	0.873	Von Hippel-Lindau disease tumor suppressor
10	9606.ENSP00000408695	0.866	Protein kinase C alpha type
11	9606.ENSP00000322457	0.858	E3 ubiquitin-protein ligase SIAH2
12	9606.ENSP00000351407	0.814	Aryl hydrocarbon receptor nuclear translocator
13	9606.ENSP00000263431	0.812	Protein kinase C gamma type
14	9606.ENSP00000305355	0.812	Protein kinase C beta type
15	9606.ENSP00000427550	0.742	Centrosomal protein of 192 kDa
16	9606.ENSP00000341422	0.734	Transmembrane prolyl 4-hydroxylase
17	9606.ENSP00000299163	0.710	Hypoxia-inducible factor 1-alpha inhibitor
18	9606.ENSP00000444856	0.679	Cullin-2
19	9606.ENSP00000356234	0.674	Lysine-specific demethylase 5B
20	9606.ENSP00000289371	0.651	Eukaryotic translation initiation factor 5B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031545	1.000	peptidyl-proline 4-dioxygenase activity
GO:0005515	0.999	protein binding
GO:0043167	0.995	ion binding
GO:0140299	0.992	small molecule sensor activity
GO:0019825	0.991	oxygen binding
GO:0043169	0.960	cation binding
GO:0046914	0.947	transition metal ion binding
GO:0005506	0.897	iron ion binding
GO:0008198	0.886	ferrous iron binding
GO:0019826	0.821	oxygen sensor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0019222	0.977	regulation of metabolic process
GO:0006950	0.970	response to stress
GO:0060255	0.933	regulation of macromolecule metabolic process
GO:0006807	0.923	nitrogen compound metabolic process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0009628	0.916	response to abiotic stimulus
GO:0043170	0.904	macromolecule metabolic process
GO:0043412	0.888	macromolecule modification
GO:1901564	0.887	organonitrogen compound metabolic process
GO:0080090	0.883	regulation of primary metabolic process
GO:0036211	0.880	protein modification process
GO:0048518	0.859	positive regulation of biological process
GO:0009987	0.817	cellular process
GO:0018193	0.749	peptidyl-amino acid modification
GO:0018208	0.626	peptidyl-proline modification
GO:0018126	0.621	protein hydroxylation
GO:0031323	0.606	regulation of cellular metabolic process
GO:0010604	0.606	positive regulation of macromolecule metabolic process
GO:0051173	0.512	positive regulation of nitrogen compound metabolic process
GO:0048522	0.453	positive regulation of cellular process
GO:0001666	0.401	response to hypoxia
GO:0051716	0.316	cellular response to stimulus
GO:0010941	0.315	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]