StarFunc result for job id Q96KV7

User Input

>input (1748 residues)
MARAWQHPFLNVFRHFRVDEWKRSAKQGDVAVVTDKTLKGAVYRIRGSVSAANYIQLPKS
STQSLGLTGRYLYVLFRPLPSKHFVIHLDVSSKDNQVIRVSFSNLFKEFKSTATWLQFPL
VLEARTPQRDLVGLAPSGARWTCLQLDLQDVLLVYLNRCYGHLKSIRLCASLLVRNLYTS
DLCFEPAISGAQWAKLPVTPMPREMAFPVPKGESWHDRYIHVRFPSESLKVPSKPIEKSC
SPPEAVLLGPGPQPLPCPVASSKPVRFSVSPVVQTPSPTASGRAALAPRPFPEVSLSQER
SDASNADGPGFHSLEPWAQLEASDIHTAAAGTHVLTHESAEVPVARTGSCEGFLPDPVLR
LKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLVDTGEQRFFLGHTDKVSALALDGS
SSLLASAQARAPSVMRLWDFQTGRCLCLFRSPMHVVCSLSFSDSGALLCGVGKDHHGRTM
VVAWGTGQVGLGGEVVVLAKAHTDFDVQAFRVTFFDETRMASCGQGSVRLWRLRGGVLRS
CPVDLGEHHALQFTDLAFKQARDGCPEPSAAMLFVCSRSGHILEIDCQRMVVRHARRLLP
TRTPGGPHPQKQTFSSGPGIAISSLSVSPAMCAVGSEDGFLRLWPLDFSSVLLEAEHEGP
VSSVCVSPDGLRVLSATSSGHLGFLDTLSRVYHMLARSHTAPVLALAMEQRRGQLATVSQ
DRTVRIWDLATLQQLYDFTSSEDAPCAVTFHPTRPTFFCGFSSGAVRSFSLEAAEVLVEH
TCHRGAVTGLTATPDGRLLFSSCSQGSLAQYSCADPQWHVLRVAADMVCPDAPASPSALA
VSRDGRLLAFVGPSRCTVTVMGSASLDELLRVDIGTLDLASSRLDSAMAVCFGPAALGHL
LVSTSSNRVVVLDAVSGRIIRELPGVHPEPCPSLTLSEDARFLLIAAGRTIKVWDYATQA
SPGPQVYIGHSEPVQAVAFSPDQQQVLSAGDAVFLWDVLAPTESDQSFPGAPPACKTGPG
AGPLEDAASRASELPRQQVPKPCQASPPRLGVCARPPEGGDGARDTRNSGAPRTTYLASC
KAFTPARVSCSPHSAKGTCPPPASGGWLRLKAVVGYSGNGRANMVWRPDTGFFAYTCGRL
VVVEDLHSGAQQHWSGHSAEISTLALSHSAQVLASASGRSSTTAHCQIRVWDVSGGLCQH
LIFPHSTTVLALAFSPDDRLLVTLGDHDGRTLALWGTATYDLVSSTRLPEPVHGVAFNPW
DAGELTCVGQGTVTFWLLQQRGADISLQVRREPVPEAVGAGELTSLCYGAPPLLYCGTSS
GQVCVWDTRAGRCFLSWEADDGGIGLLLFSGSRLVSGSSTGRLRLWAVGAVSELRCKGSG
ASSVFMEHELVLDGAVVSASFDDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSKVNE
VVFSPGESHCATCSEDGSVRVWALASMELVIQFQVLNQSCLCLAWSPPCCGRPEQQRLAA
GYGDGSLRIFSVSRTAMELKMHPHPVALTTVAFSTDGQTVLSGDKDGLVAVSHPCTGTTF
RVLSDHQGAPISTICVTCKECEDLGVEGTDLWLAASGDQRVSVWASDWLRNHCELVDWLS
FPMPATTETQGHLPPSLAAFCPWDGALLMYVGPGVYKEVIIYNLCQKQVVEKIPLPFFAM
SLSLSPGTHLLAVGFAECMLRLVDCAMGTAQDFAGHDNAVHLCRFTPSARLLFTAARNEI
LVWEVPGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96KV7	1.000	1.000	0.000	1748	1.000	1.000	Q96KV7.pdb.gz	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
2	PDB:7rroe	0.307	0.824	5.225E-35	610	0.067	0.192	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
3	AFDB:F1Q8Y1	0.308	0.541	1.160E-33	963	0.068	0.124	F1Q8Y1.pdb.gz	F1Q8Y1_DANRE Cilia- and flagella-associated protein 251 isoform X1 OS=Danio rerio OX=7955 GN=wdr66 PE=4 SV=2
4	PDB:7mqaLQ	0.276	0.534	2.366E-30	830	0.063	0.133	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	AFDB:Q9LFE2	0.250	0.444	8.140E-30	876	0.064	0.127	Q9LFE2.pdb.gz	TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE OS=Arabidopsis thaliana OX=3702 GN=TOZ PE=1 SV=1
6	PDB:7mqaLO	0.292	0.588	3.071E-29	819	0.064	0.137	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	AFDB:Q5TDG3	0.270	0.462	6.631E-29	943	0.064	0.119	Q5TDG3.pdb.gz	Q5TDG3_HUMAN WD repeat domain 3, isoform CRA_b OS=Homo sapiens OX=9606 GN=WDR3 PE=2 SV=1
8	PDB:7mq8LO	0.289	0.567	8.973E-29	848	0.064	0.132	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7ajtUA	0.286	0.563	6.659E-28	834	0.061	0.128	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:7mq8LR	0.251	0.485	2.456E-27	773	0.058	0.131	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7mq8LT	0.277	0.510	8.645E-27	869	0.052	0.105	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7ajuUL	0.268	0.534	1.091E-26	779	0.057	0.128	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:6lqsB1	0.289	0.588	1.822E-26	806	0.063	0.136	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:6jp6A	0.107	0.172	1.909E-26	998	0.085	0.149	6jp6A.pdb.gz
15	AFDB:Q57UQ2	0.113	0.144	8.293E-26	1110	0.080	0.126	Q57UQ2.pdb.gz	Q57UQ2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.310 PE=4 SV=1
16	AFDB:O14301	0.296	0.797	3.059E-25	595	0.050	0.146	O14301.pdb.gz	YE85_SCHPO Uncharacterized WD repeat-containing protein C9G1.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.05 PE=3 SV=1
17	AFDB:Q9CAA0	0.155	0.290	2.126E-23	920	0.045	0.086	Q9CAA0.pdb.gz	COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana OX=3702 GN=At1g79990 PE=2 SV=2
18	AFDB:Q96WV5	0.149	0.214	7.347E-22	1207	0.051	0.074	Q96WV5.pdb.gz	COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPJ4664.04 PE=1 SV=1
19	AFDB:P53622	0.168	0.223	3.934E-21	1201	0.041	0.059	P53622.pdb.gz	COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COP1 PE=1 SV=2
20	AFDB:A0A2R8RUW2	0.151	0.265	5.452E-21	981	0.045	0.080	A0A2R8RUW2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96KV7	0.0	3536	1748	1.000	1.000	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
2	Q05BV3	9.75e-37	155	1969	0.161	0.143	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
3	E1BKF9	6.94e-27	120	623	0.078	0.218	CFA52_BOVIN Cilia- and flagella-associated protein 52 OS=Bos taurus OX=9913 GN=CFAP52 PE=1 SV=1
4	Q8N1V2	1.05e-25	117	620	0.078	0.219	CFA52_HUMAN Cilia- and flagella-associated protein 52 OS=Homo sapiens OX=9606 GN=CFAP52 PE=1 SV=3
5	A8ILK1	2.12e-24	112	615	0.087	0.247	CFA52_CHLRE Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP52 PE=1 SV=1
6	F1SS88	1.24e-21	103	620	0.077	0.218	CFA52_PIG Cilia- and flagella-associated protein 52 OS=Sus scrofa OX=9823 GN=CFAP52 PE=1 SV=3
7	Q6P6T4	7.12e-17	89.0	649	0.065	0.176	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
8	A0A0A1CTQ1	2.78e-16	86.3	506	0.061	0.211	A0A0A1CTQ1_SCHMD Wdr-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=wdr-1 PE=2 SV=1
9	O95834	2.82e-16	87.0	649	0.064	0.173	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
10	Q9VUI3	1.70e-14	82.0	1076	0.073	0.119	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
11	A0A2R8RMY7	4.54e-14	80.1	817	0.062	0.132	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
12	E7EXY5	6.93e-14	79.7	813	0.062	0.133	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
13	O00423	2.19e-13	78.2	815	0.059	0.126	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
14	Q05BC3	3.49e-13	77.4	814	0.059	0.127	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
15	A0A0C4DGQ7	8.87e-13	74.7	427	0.056	0.230	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
16	Q9HC35	1.51e-12	75.5	981	0.063	0.112	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
17	B5MBZ0	1.80e-12	75.1	992	0.063	0.111	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
18	P25382	8.01e-12	72.4	515	0.055	0.188	NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSA4 PE=1 SV=3
19	Q3UMY5	1.07e-11	72.8	988	0.063	0.111	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
20	Q7ZUV2	1.21e-11	72.0	694	0.030	0.075	KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio OX=7955 GN=katnb1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.4e-12	57.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF05018 CFA20_dom	6.1e-30	115.8	CFA20 domain
3	PF16529 Ge1_WD40	1.1e+02	13.3	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF03451 HELP	2e+02	13.3	HELP motif
5	PF20426 NBCH_WD40	0.8	20.1	Neurobeachin beta propeller domain
6	PF08801 Nucleoporin_N	3.6e+02	11.3	Nup133 N terminal like
7	PF11715 Nup160	0.66	20.3	Nucleoporin Nup120/160
8	PF00400 WD40	8e-33	123.1	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293879

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357079	0.842	Cilia and flagella associated protein 45
2	9606.ENSP00000401010	0.828	F-actin-capping protein subunit beta
3	9606.ENSP00000331044	0.818	Enkurin
4	9606.ENSP00000360107	0.802	EF-hand domain-containing protein 1
5	9606.ENSP00000219302	0.796	Nucleoside diphosphate kinase 3
6	9606.ENSP00000471454	0.795	Coiled-coil domain containing 61
7	9606.ENSP00000219479	0.788	Nucleoside diphosphate kinase, mitochondrial
8	9606.ENSP00000404232	0.788	EF-hand domain-containing family member C2
9	9606.ENSP00000295124	0.775	Coiled-coil domain containing 138
10	9606.ENSP00000280020	0.773	Protein hinderin
11	9606.ENSP00000297185	0.765	Stress-70 protein, mitochondrial
12	9606.ENSP00000260453	0.764	Meiosis-specific nuclear structural protein 1
13	9606.ENSP00000342295	0.762	Ankyrin repeat domain-containing protein 55
14	9606.ENSP00000364476	0.759	RIB43A domain with coiled-coils 1
15	9606.ENSP00000483356	0.759	RIB43A domain with coiled-coils 2
16	9606.ENSP00000312399	0.742	Coiled-coil domain-containing protein 63
17	9606.ENSP00000318429	0.742	Coiled-coil domain-containing protein 114
18	9606.ENSP00000298832	0.737	Tubulin polyglutamylase TTLL5
19	9606.ENSP00000317144	0.732	Progesterone-induced-blocking factor 1
20	9606.ENSP00000287380	0.729	TBC1 domain family member 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0070925	0.971	organelle assembly
GO:0044782	0.931	cilium organization
GO:0120031	0.903	plasma membrane bounded cell projection assembly
GO:0060271	0.843	cilium assembly
GO:0065007	0.604	biological regulation
GO:0050789	0.532	regulation of biological process
GO:0050794	0.455	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005815	0.989	microtubule organizing center
GO:0043227	0.965	membrane-bounded organelle
GO:0005737	0.822	cytoplasm
GO:0043231	0.817	intracellular membrane-bounded organelle
GO:0005814	0.754	centriole
GO:0005634	0.721	nucleus
GO:0070013	0.478	intracellular organelle lumen
GO:0031981	0.432	nuclear lumen
GO:0120025	0.331	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]