StarFunc result for job id Q96KW2

User Input

>input (1035 residues)
MGSFLSKLELSPSSPAQVRTDLPERPTKRRPPQPLHQVHRVQFVHRAHPAPRYRPVRRRP
NLDPANPTTWLANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRTIWSLRHPRPIWSPVTI
RITPPDQRVPPSTSPEDVIALAGLPPSEELADPCSKETVLRALRECRKGKGRLEEPLFPE
SLDSKRRSPETRPSAFKPLMKNGTLTSFVPRPGPLKRSLHSWGSDHSLTKRPNCSSMSSL
ASIYRGGTLSSKRNAIGSSYSSCRNFSDPWKRSVPSVSFETPEWPIKKEKSCHRPSSPVP
LVSDFESLGGSESSGQQNQKIPQLPSSPENLVSEIPPPQLGYAVSDENLTLGKKAELQVS
NNAGEDTTEVNTDPFPETWLAIQPSLSLALPSSETDLTQGANPQLENLRKMQKSLGPLAS
PQSTGEATSVAHSPLKTPSLPTPPGCSQSELLPGTSPDSKPTATFILLTPTSPTLPVTDT
TWPPSTSQADRSPMPPDPPAPPTIQSTLLGMVSSPTSHLSASAPPDATSAHLMLKPILGP
LHNSEIGSSSYSRISVTAAASSISSLSTIQGTLTPTFKPIFGSIDPLKTTPMIAPFSSKQ
TPPPFTHASTHHFHGLVKATSVVMSTTLASTSKDSVFKPPLDFGVVNVTSAVGNTYSVPS
TCDTFLLGTAQAFRADFTPATGFIFPPHHHPTIPTVHTVTMFTQVLSSVVQISPRSSTAN
FRGMGSPLPASALVSTNWLASTPSISNLTPAITSPLGSSSRPPFPLSQGANPQPAFGATN
GQKQGPSQPALMPSVSSSFLFGSSAVALPTPMPTPAQPAFISTTQSALGCLTPSASTSQT
PASTWSGIGGIPAGFPISQASTTGFRIVIQTHQSGAFGSVFGSRAPQPFTFGGFVTPMDC
DESGIIMTGPDMSPTSGAFSIGALPSGTTNTMIPFGKGWSQNTEGLPSHRTAFSLGRGSI
SARKTMAPIAQNTPVPGQAKAGSSVGFGMPFPPAQGSVGRGPFRSSASSFSIGAKSKTPK
NREKGHSRRHHAYKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HA1	0.049	0.043	1.508E-36	1249	0.424	0.351	Q96HA1.pdb.gz	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
2	AFDB:P52591	0.063	0.057	1.680E-33	1199	0.404	0.349	P52591.pdb.gz	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
3	AFDB:Q9NZP6	0.044	0.041	6.207E-4	1156	0.243	0.217	Q9NZP6.pdb.gz	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
4	AFDB:F4I1T7	0.040	0.028	1.364E-3	1819	0.178	0.101	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
5	AFDB:Q09904	0.036	0.033	1.364E-3	1159	0.172	0.154	Q09904.pdb.gz	NU124_SCHPO Nucleoporin nup124 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup124 PE=1 SV=1
6	AFDB:P91457	0.036	0.033	1.817E-3	1217	0.182	0.154	P91457.pdb.gz	P91457_CAEEL RanBP2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-7 PE=1 SV=1
7	AFDB:Q5T8A7	0.047	0.042	3.221E-3	1209	0.165	0.141	Q5T8A7.pdb.gz	PPR26_HUMAN Protein phosphatase 1 regulatory subunit 26 OS=Homo sapiens OX=9606 GN=PPP1R26 PE=1 SV=1
8	AFDB:O75362	0.058	0.057	3.717E-3	1048	0.155	0.153	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
9	AFDB:Q9CAF4	0.044	0.038	1.556E-2	1309	0.212	0.167	Q9CAF4.pdb.gz	NUP1_ARATH Nuclear pore complex protein NUP1 OS=Arabidopsis thaliana OX=3702 GN=NUP1 PE=1 SV=1
10	AFDB:Q640Z6	0.041	0.033	2.391E-2	1605	0.201	0.130	Q640Z6.pdb.gz	NU153_XENLA Nuclear pore complex protein Nup153 OS=Xenopus laevis OX=8355 GN=nup153 PE=1 SV=1
11	PDB:7mqaNB	0.039	0.232	2.010	103	0.016	0.165	7mqaNB.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:5wvmA	0.023	0.039	3.088	492	0.010	0.020	5wvmA.pdb.gz
13	PDB:7d58N	0.023	0.095	4.112	136	0.016	0.125	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
14	PDB:6o9lQ	0.035	0.070	5.097	430	0.022	0.053	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:6zheC	0.027	0.039	6.787	705	0.015	0.023	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
16	PDB:7dvqR	0.021	0.072	6.787	241	0.022	0.095	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:6wkrC	0.030	0.043	7.291	606	0.010	0.017	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
18	PDB:3j6bW	0.026	0.140	8.413	112	0.014	0.125	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
19	PDB:5oqmm	0.024	0.122	8.413	103	0.017	0.175	5oqmm.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
20	PDB:5o9zH	0.029	0.061	9.037	413	0.014	0.036	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8CG34	6.26e-155	493	1229	0.434	0.365	P121C_HUMAN Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3
2	Q96HA1	2.60e-151	484	1249	0.429	0.355	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
3	P52591	4.73e-115	385	1199	0.403	0.348	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
4	Q3SYA9	4.21e-13	75.1	428	0.100	0.243	P12L1_HUMAN Putative POM121-like protein 1 OS=Homo sapiens OX=9606 GN=POM121L1P PE=5 SV=2
5	Q6PJE2	6.24e-09	58.9	187	0.039	0.214	POZP3_HUMAN POM121 and ZP3 fusion protein OS=Homo sapiens OX=9606 GN=POMZP3 PE=2 SV=4
6	C9J370	3.51e-08	58.2	250	0.033	0.136	C9J370_HUMAN POM121 and ZP3 fusion (Fragment) OS=Homo sapiens OX=9606 GN=POMZP3 PE=4 SV=1
7	Q9NZP6	1.20e-06	55.5	1156	0.064	0.057	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15229 POM121	1e-30	118.8	POM121 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392726

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378687	0.800	Nuclear envelope pore membrane protein POM 121
2	9606.ENSP00000481575	0.800	Nuclear envelope pore membrane protein POM 121C
3	9606.ENSP00000358896	0.662	Arsenite methyltransferase
4	9606.ENSP00000230582	0.600	Thymus-specific serine protease
5	9606.ENSP00000358894	0.587	Metal transporter CNNM2
6	9606.ENSP00000366365	0.573	Olfactory receptor 14J1
7	9606.ENSP00000211936	0.561	Zinc finger protein 184
8	9606.ENSP00000366798	0.561	High mobility group nucleosomal binding domain 4
9	9606.ENSP00000339479	0.557	Cytosolic purine 5'-nucleotidase
10	9606.ENSP00000482607	0.557	Zinc finger protein 322
11	9606.ENSP00000333037	0.554	Actin related protein T3
12	9606.ENSP00000258704	0.522	Speedy protein E1
13	9606.ENSP00000274849	0.519	Activator of basal transcription 1
14	9606.ENSP00000421686	0.516	Speedy protein E2
15	9606.ENSP00000312158	0.506	Butyrophilin subfamily 2 member A1
16	9606.ENSP00000370669	0.505	Sodium/calcium exchanger 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0008152	0.355	metabolic process
GO:0071704	0.349	organic substance metabolic process
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0012505	0.998	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0016020	0.993	membrane
GO:0005635	0.986	nuclear envelope
GO:0005654	0.986	nucleoplasm
GO:0031090	0.694	organelle membrane
GO:0031965	0.684	nuclear membrane
GO:0005737	0.601	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]