StarFunc result for job id Q96L33

User Input

>input (236 residues)
MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARY
RPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQN
ITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRA
CCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96L33	1.000	1.000	2.168E-47	236	1.000	1.000	Q96L33.pdb.gz	RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens OX=9606 GN=RHOV PE=1 SV=1
2	AFDB:Q5YLG6	0.845	0.848	7.874E-33	235	0.581	0.583	Q5YLG6.pdb.gz	Q5YLG6_DANRE Novel protein similar to vertebrate ras homolog gene family, member V (RHOV) OS=Danio rerio OX=7955 GN=OTTDARP00000007023 PE=2 SV=1
3	AFDB:Q9EQT3	0.791	0.717	7.973E-31	261	0.551	0.498	Q9EQT3.pdb.gz	RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus OX=10090 GN=Rhou PE=2 SV=1
4	AFDB:Q5U3T8	0.793	0.739	4.130E-30	254	0.568	0.528	Q5U3T8.pdb.gz	Q5U3T8_DANRE Ras homolog family member Ua OS=Danio rerio OX=7955 GN=zgc:101642 PE=2 SV=1
5	AFDB:G5EBV3	0.747	0.901	2.033E-27	195	0.415	0.503	G5EBV3.pdb.gz	G5EBV3_CAEEL Rac-like GTPase OS=Caenorhabditis elegans OX=6239 GN=mig-2 PE=1 SV=1
6	AFDB:P40793	0.743	0.916	4.077E-27	191	0.424	0.524	P40793.pdb.gz	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
7	AFDB:Q05062	0.739	0.911	4.929E-27	191	0.419	0.518	Q05062.pdb.gz	CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans OX=6239 GN=cdc-42 PE=1 SV=2
8	AFDB:A2QFE0	0.747	0.916	5.594E-27	192	0.394	0.484	A2QFE0.pdb.gz	A2QFE0_ASPNC Cell division control protein 42 homolog OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g14200 PE=3 SV=1
9	AFDB:P0CY33	0.740	0.912	5.594E-27	191	0.403	0.497	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
10	AFDB:A0JC80	0.744	0.880	6.348E-27	199	0.424	0.503	A0JC80.pdb.gz	A0JC80_9HYPO RacA OS=Epichloe festucae OX=35717 GN=racA PE=2 SV=1
11	PDB:1nf3A	0.756	0.916	3.409E-26	194	0.436	0.531	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
12	PDB:2wkpA	0.727	0.539	2.422E-25	320	0.415	0.306	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:6ukaA	0.724	0.959	2.217E-24	177	0.377	0.503	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
14	PDB:6hxuA	0.738	0.952	1.012E-23	182	0.331	0.429	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
15	PDB:4mitC	0.742	0.964	1.388E-23	181	0.301	0.392	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
16	PDB:6jikA	0.748	0.965	1.905E-23	182	0.322	0.418	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
17	PDB:2atxA	0.734	0.923	3.365E-23	186	0.415	0.527	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
18	PDB:5c2kA	0.741	0.461	3.585E-23	382	0.326	0.202	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
19	PDB:3a58F	0.731	0.947	2.055E-21	181	0.322	0.420	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
20	PDB:2j0vB	0.666	0.843	5.871E-20	184	0.339	0.435	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96L33	1.32e-175	483	236	1.000	1.000	RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens OX=9606 GN=RHOV PE=1 SV=1
2	Q9Z1Y0	2.15e-172	475	236	0.983	0.983	RHOV_RAT Rho-related GTP-binding protein RhoV OS=Rattus norvegicus OX=10116 GN=Rhov PE=1 SV=1
3	Q7L0Q8	2.84e-88	263	258	0.538	0.492	RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens OX=9606 GN=RHOU PE=1 SV=1
4	Q9EQT3	1.33e-86	259	261	0.530	0.479	RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus OX=10090 GN=Rhou PE=2 SV=1
5	Q5U3T8	8.86e-85	254	254	0.551	0.512	Q5U3T8_DANRE Ras homolog family member Ua OS=Danio rerio OX=7955 GN=zgc:101642 PE=2 SV=1
6	Q5YLG6	1.36e-80	243	235	0.521	0.523	Q5YLG6_DANRE Novel protein similar to vertebrate ras homolog gene family, member V (RHOV) OS=Danio rerio OX=7955 GN=OTTDARP00000007023 PE=2 SV=1
7	P40793	7.39e-70	214	191	0.424	0.524	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
8	Q6PFU4	7.55e-70	214	191	0.428	0.529	Q6PFU4_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
9	P40792	1.11e-69	214	192	0.419	0.516	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
10	P60766	1.16e-69	213	191	0.428	0.529	CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus OX=10090 GN=Cdc42 PE=1 SV=2
11	P60953	1.16e-69	213	191	0.428	0.529	CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2
12	Q8CFN2	1.16e-69	213	191	0.428	0.529	CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2
13	Q52WY2	3.92e-69	212	191	0.424	0.524	Q52WY2_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
14	Q5DR84	4.41e-69	212	199	0.424	0.503	Q5DR84_ASPNG CorA-like Mg2+ transporter family protein OS=Aspergillus niger OX=5061 GN=AnigIFM60653_002925 PE=4 SV=1
15	P62998	5.32e-69	212	192	0.415	0.510	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
16	P63000	5.32e-69	212	192	0.415	0.510	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1
17	P63001	5.32e-69	212	192	0.415	0.510	RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1
18	Q6LC82	5.32e-69	212	192	0.415	0.510	Q6LC82_CHICK GTPase cRac1A OS=Gallus gallus OX=9031 GN=cRac1A PE=2 SV=1
19	Q6RUV5	5.32e-69	212	192	0.415	0.510	RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1
20	P48554	7.39e-69	211	192	0.415	0.510	RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster OX=7227 GN=Rac2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13481 AAA_25	5.2e+02	11.6	AAA domain
2	PF00025 Arf	0.82	20.6	ADP-ribosylation factor family
3	PF01926 MMR_HSR1	14	17.2	50S ribosome-binding GTPase
4	PF00071 Ras	2e-42	156.1	Ras family
5	PF08477 Roc	3.7e-16	70.8	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008568473.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008574520.1	0.799	Rho GDP-dissociation inhibitor 1
2	482537.XP_008578230.1	0.778	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 3 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments
3	482537.XP_008569143.1	0.771	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 25 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
4	482537.XP_008587398.1	0.771	Intersectin-2
5	482537.XP_008565711.1	0.766	Rho GTPase-activating protein 15
6	482537.XP_008569666.1	0.746	wiskott-Aldrich syndrome protein
7	482537.XP_008582604.1	0.742	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 22 Proteins, and 69% coverage of the annotated genomic feature by RNAseq alignments
8	482537.XP_008564720.1	0.728	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 8 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
9	482537.XP_008568831.1	0.728	Dynamin-binding protein
10	482537.XP_008576980.1	0.711	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
11	482537.XP_008585450.1	0.706	Citron Rho-interacting kinase
12	482537.XP_008581903.1	0.702	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 87% coverage of the annotated genomic feature by RNAseq alignments
13	482537.XP_008564725.1	0.684	T-lymphoma invasion and metastasis-inducing protein 1
14	482537.XP_008569269.1	0.676	Unconventional myosin-IXa
15	482537.XP_008578760.1	0.676	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
16	482537.XP_008591953.1	0.676	Delphilin
17	482537.XP_008565222.1	0.675	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
18	482537.XP_008568424.1	0.675	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	482537.XP_008569993.1	0.672	Rho-related GTP-binding protein RhoJ-like
20	482537.XP_008583915.1	0.666	Neuroepithelial cell-transforming gene 1 protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0003924	0.723	GTPase activity
GO:0032561	0.377	guanyl ribonucleotide binding
GO:0043167	0.360	ion binding
GO:0043168	0.329	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0007165	0.949	signal transduction
GO:0048583	0.537	regulation of response to stimulus
GO:0071840	0.525	cellular component organization or biogenesis
GO:0016043	0.501	cellular component organization
GO:0048518	0.445	positive regulation of biological process
GO:0048522	0.403	positive regulation of cellular process
GO:0023051	0.374	regulation of signaling
GO:0010646	0.370	regulation of cell communication
GO:0009966	0.348	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005737	0.979	cytoplasm
GO:0043226	0.964	organelle
GO:0005829	0.916	cytosol
GO:0043227	0.906	membrane-bounded organelle
GO:0043229	0.904	intracellular organelle
GO:0043231	0.681	intracellular membrane-bounded organelle
GO:0012505	0.566	endomembrane system
GO:0031982	0.489	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.723	GTP + H2O = GDP + H(+) + phosphate

[back to server]