StarFunc result for job id Q96L34

User Input

>input (752 residues)
MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A6T9	0.698	0.698	0.000	752	0.977	0.977	D4A6T9.pdb.gz	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
2	AFDB:A0A0G2JTD8	0.463	0.505	7.480E-84	688	0.828	0.906	A0A0G2JTD8.pdb.gz	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
3	AFDB:P27448	0.572	0.571	6.585E-77	753	0.634	0.633	P27448.pdb.gz	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
4	AFDB:Q8VHJ5	0.551	0.523	5.228E-70	795	0.585	0.553	Q8VHJ5.pdb.gz	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2
5	AFDB:E7ETY4	0.562	0.554	1.720E-66	763	0.568	0.560	E7ETY4.pdb.gz	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
6	AFDB:Q7KZI7	0.558	0.534	3.728E-66	788	0.556	0.530	Q7KZI7.pdb.gz	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
7	AFDB:A1ZBL5	0.549	0.436	1.221E-65	951	0.476	0.376	A1ZBL5.pdb.gz	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
8	AFDB:A1ZBL7	0.441	0.335	8.377E-53	993	0.416	0.315	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
9	AFDB:Q14680	0.467	0.533	4.297E-39	651	0.265	0.306	Q14680.pdb.gz	MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK PE=1 SV=3
10	AFDB:Q61846	0.479	0.552	1.145E-38	643	0.263	0.308	Q61846.pdb.gz	MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus OX=10090 GN=Melk PE=1 SV=2
11	PDB:7myjC	0.347	0.552	1.905E-30	465	0.210	0.340	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:6b1uA	0.348	0.585	2.152E-29	442	0.178	0.303	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	PDB:4zhxA	0.346	0.627	5.270E-28	409	0.174	0.320	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:5ufuA	0.347	0.697	1.142E-27	369	0.166	0.339	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
15	PDB:4rerA	0.352	0.566	4.599E-27	459	0.178	0.292	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:4rewA	0.336	0.608	2.657E-26	411	0.169	0.309	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5u6yA	0.328	0.528	3.160E-25	459	0.141	0.231	5u6yA.pdb.gz
18	PDB:4d28C	0.322	0.824	9.510E-24	279	0.156	0.419	4d28C.pdb.gz
19	PDB:4cztD	0.314	0.734	2.668E-23	302	0.154	0.384	4cztD.pdb.gz
20	PDB:6byrA	0.330	0.601	2.452E-22	405	0.132	0.244	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTD8	1286	744	0.832	0.841	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
2	A0A8I6A623	1263	688	0.816	0.892	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1
3	A1ZBL5	564	951	0.340	0.269	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
4	A1ZBL7	566	993	0.340	0.258	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
5	A1ZBL9	640	1170	0.477	0.307	A1ZBL9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
6	D4A6T9	1512	752	0.977	0.977	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
7	E1JGM9	572	827	0.340	0.310	E1JGM9_DROME Par-1, isoform S OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
8	E1JGN0	560	1141	0.340	0.224	E1JGN0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
9	E7ETY4	729	763	0.570	0.562	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
10	E9PC69	736	778	0.573	0.554	E9PC69_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=3
11	O08678	790	793	0.597	0.566	MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus OX=10116 GN=Mark1 PE=1 SV=1
12	O08679	746	722	0.574	0.598	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1
13	P27448	912	753	0.640	0.639	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
14	Q03141	917	753	0.642	0.641	MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus OX=10090 GN=Mark3 PE=1 SV=2
15	Q05512	728	776	0.569	0.552	MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus OX=10090 GN=Mark2 PE=1 SV=3
16	Q6NPA6	572	833	0.340	0.307	Q6NPA6_DROME Par-1, isoform L OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
17	Q7KZI7	724	788	0.573	0.547	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
18	Q7YU80	566	1046	0.340	0.245	Q7YU80_DROME Par-1, isoform R OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
19	Q8CIP4	1512	752	0.976	0.976	MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus OX=10090 GN=Mark4 PE=1 SV=1
20	Q8VHJ5	787	795	0.593	0.561	MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus OX=10090 GN=Mark1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.8	19.1	ABC1 atypical kinase-like domain
2	PF02149 KA1	5.2e-09	47.0	Kinase associated domain 1
3	PF06293 Kdo	1.3	19.9	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	0.028	25.4	Kinase-like
5	PF00069 Pkinase	1.4e-72	255.9	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	1.9e-41	153.7	Protein tyrosine and serine/threonine kinase
7	PF01163 RIO1	1.5	19.9	RIO1 family
8	PF00627 UBA	0.053	24.7	UBA/TS-N domain
9	PF08587 UBA_2	15	17.1	Ubiquitin associated domain (UBA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324856	0.945	Serine/threonine-protein kinase STK11
2	9606.ENSP00000258418	0.933	Calcium-binding protein 39
3	9606.ENSP00000336655	0.916	STE20-related kinase adapter protein alpha
4	9606.ENSP00000194530	0.910	STE20-related kinase adapter protein beta
5	9606.ENSP00000435648	0.826	Glutamate receptor ionotropic, kainate 4
6	9606.ENSP00000070846	0.820	Plakophilin-2
7	9606.ENSP00000316357	0.803	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
8	9606.ENSP00000251413	0.753	Tubulin gamma-1 chain
9	9606.ENSP00000354837	0.727	Rho guanine nucleotide exchange factor 2
10	9606.ENSP00000248846	0.726	Gamma-tubulin complex component 6
11	9606.ENSP00000353735	0.726	E3 ubiquitin-protein ligase Topors
12	9606.ENSP00000418960	0.723	Breast cancer type 1 susceptibility protein
13	9606.ENSP00000260383	0.720	Gamma-tubulin complex component 4
14	9606.ENSP00000281871	0.720	Mitotic spindle organizing protein 2B
15	9606.ENSP00000311500	0.720	Mitotic spindle organizing protein 2A
16	9606.ENSP00000359398	0.720	Biogenesis of lysosome-related organelles complex 1 subunit 2
17	9606.ENSP00000367049	0.720	Mitotic-spindle organizing protein 1
18	9606.ENSP00000371308	0.720	Centromere protein J
19	9606.ENSP00000480316	0.720	Gamma-tubulin complex component 5
20	9606.ENSP00000393840	0.690	Biogenesis of lysosome-related organelles complex 1 subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004674	0.997	protein serine/threonine kinase activity
GO:0060090	0.995	molecular adaptor activity
GO:0008093	0.990	cytoskeletal anchor activity
GO:0050321	0.727	tau-protein kinase activity
GO:0097159	0.632	organic cyclic compound binding
GO:1901363	0.629	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0051128	0.994	regulation of cellular component organization
GO:0044089	0.984	positive regulation of cellular component biogenesis
GO:0051130	0.981	positive regulation of cellular component organization
GO:0043254	0.901	regulation of protein-containing complex assembly
GO:0044237	0.880	cellular metabolic process
GO:0031334	0.878	positive regulation of protein-containing complex assembly
GO:0033043	0.822	regulation of organelle organization
GO:0071704	0.784	organic substance metabolic process
GO:0044238	0.783	primary metabolic process
GO:0006807	0.755	nitrogen compound metabolic process
GO:0071840	0.741	cellular component organization or biogenesis
GO:1901564	0.736	organonitrogen compound metabolic process
GO:0016043	0.705	cellular component organization
GO:0019538	0.630	protein metabolic process
GO:0036211	0.619	protein modification process
GO:0006793	0.613	phosphorus metabolic process
GO:0006996	0.455	organelle organization
GO:0006796	0.434	phosphate-containing compound metabolic process
GO:0019222	0.412	regulation of metabolic process
GO:0050896	0.383	response to stimulus
GO:0048519	0.345	negative regulation of biological process
GO:0048523	0.343	negative regulation of cellular process
GO:0032501	0.336	multicellular organismal process
GO:0051716	0.332	cellular response to stimulus
GO:0060255	0.332	regulation of macromolecule metabolic process
GO:0006468	0.329	protein phosphorylation
GO:0007010	0.310	cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.996	cytoskeleton
GO:0005737	0.991	cytoplasm
GO:0015630	0.976	microtubule cytoskeleton
GO:0043227	0.975	membrane-bounded organelle
GO:0005815	0.970	microtubule organizing center
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0032991	0.933	protein-containing complex
GO:0016020	0.873	membrane
GO:0005829	0.869	cytosol
GO:0005813	0.820	centrosome
GO:0005634	0.661	nucleus
GO:0071944	0.421	cell periphery
GO:0005886	0.358	plasma membrane
GO:0070013	0.331	intracellular organelle lumen
GO:0005654	0.319	nucleoplasm
GO:0036477	0.311	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.26	0.727	[tau protein] kinase.

[back to server]