StarFunc result for job id Q96L42

User Input

>input (1107 residues)
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKVKGRSRAGTHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSMVSQSEPKGNGNINKRLPSIVEDEEEEEEGE
EEEAVSLSPICTRGSSSRNKKVGSNKAYLGLSLKQLASGTVPFHSPIRVSRSNSPKTKQE
IDPPNHNKRKEKNLKLQLSTLNNAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRSEP
RISPPLGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRNVIQLLENVLS
PQQPSRFCSLHSTSVCPSRESLQTRTSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIWS
VDPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHLQFLRCISPHSDSTL
TPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASA
STKPLENLPLEVVTSTAEVKDNKAINV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96L42	1.000	1.000	0.000	1107	1.000	1.000	Q96L42.pdb.gz	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
2	AFDB:Q9UQ05	0.593	0.644	3.467E-102	1017	0.522	0.568	Q9UQ05.pdb.gz	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
3	AFDB:A8WHX9	0.603	0.727	4.325E-98	914	0.522	0.632	A8WHX9.pdb.gz	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
4	AFDB:Q9ULD8	0.597	0.610	9.541E-94	1083	0.486	0.497	Q9ULD8.pdb.gz	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
5	AFDB:Q63472	0.537	0.615	1.117E-70	962	0.288	0.332	Q63472.pdb.gz	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
6	AFDB:B3DHL9	0.548	0.630	5.569E-70	959	0.291	0.336	B3DHL9.pdb.gz
7	AFDB:A0A0R4IEI6	0.544	0.626	2.636E-69	956	0.294	0.340	A0A0R4IEI6.pdb.gz
8	PDB:7rhsA	0.348	0.799	3.963E-27	456	0.098	0.237	7rhsA.pdb.gz
9	PDB:7n15A	0.345	0.683	3.416E-25	520	0.093	0.198	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
10	PDB:7rhsD	0.335	0.779	2.520E-23	441	0.076	0.190	7rhsD.pdb.gz
11	PDB:7wswA	0.338	0.714	9.696E-23	472	0.093	0.218	7wswA.pdb.gz
12	PDB:7o4hB	0.345	0.753	4.834E-22	468	0.093	0.220	7o4hB.pdb.gz
13	PDB:7calA	0.333	0.776	9.986E-22	444	0.089	0.221	7calA.pdb.gz
14	PDB:7xufA	0.312	0.653	6.793E-21	476	0.085	0.197	7xufA.pdb.gz
15	PDB:7o4hD	0.238	0.631	4.614E-13	383	0.052	0.151	7o4hD.pdb.gz
16	PDB:2wkpA	0.103	0.342	2.512E-9	320	0.033	0.113	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
17	PDB:6eo1A	0.119	0.276	1.854E-7	355	0.062	0.194	6eo1A.pdb.gz
18	AFDB:Q92953	0.086	0.098	1.194E-6	911	0.115	0.139	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
19	AFDB:Q6PRD1	0.070	0.039	7.377E-4	2367	0.138	0.065	Q6PRD1.pdb.gz	GP179_HUMAN Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2
20	AFDB:Q8CIR4	0.103	0.066	1.374E-3	2028	0.080	0.044	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8WHX9	0.0	960	914	0.490	0.593	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
2	O54853	0.0	622	950	0.284	0.331	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
3	Q96L42	0.0	2293	1107	1.000	1.000	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
4	Q9H252	0.0	619	994	0.282	0.314	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
5	Q9QWS8	0.0	2013	1102	0.921	0.926	KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2
6	Q9ULD8	0.0	936	1083	0.469	0.479	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
7	Q9UQ05	0.0	1065	1017	0.527	0.573	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
8	Q63472	5.96e-179	551	962	0.258	0.297	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
9	K4EHU2	6.19e-177	545	956	0.258	0.299	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
10	Q02280	2.20e-175	548	1174	0.261	0.246	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
11	Q8NCM2	3.97e-175	541	988	0.272	0.305	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
12	O18965	4.29e-175	541	987	0.260	0.292	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
13	O95259	5.55e-175	541	989	0.259	0.290	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
14	Q60603	6.78e-175	541	989	0.259	0.290	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
15	Q9EPI9	1.46e-174	540	988	0.249	0.279	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
16	Q108P3	3.27e-172	533	959	0.254	0.293	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
17	Q9NS40	2.19e-162	514	1196	0.237	0.219	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
18	O54852	2.64e-160	509	1195	0.223	0.207	KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus OX=10116 GN=Kcnh7 PE=1 SV=1
19	O44164	7.79e-160	501	956	0.257	0.297	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
20	O08962	3.80e-158	502	1163	0.221	0.211	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10473 CENP-F_leu_zip	47	15.4	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
2	PF00027 cNMP_binding	1.7e-05	36.2	Cyclic nucleotide-binding domain
3	PF11172 DUF2959	2.5e+02	13.2	Protein of unknown function (DUF2959)
4	PF18904 DUF5660	1.4e+02	14.2	Domain of unknown function (DUF5660)
5	PF06757 Ins_allergen_rp	1.4e+02	13.8	Insect allergen related repeat, nitrile-specifier detoxification
6	PF00520 Ion_trans	2.4e-30	117.1	Ion transport protein
7	PF07885 Ion_trans_2	1.6e-07	42.5	Ion channel
8	PF00989 PAS	0.03	25.7	PAS fold
9	PF08447 PAS_3	0.00029	32.4	PAS fold
10	PF08448 PAS_4	0.032	25.9	PAS fold
11	PF13426 PAS_9	4.3e-15	67.2	PAS domain
12	PF04102 SlyX	4.8e+02	12.8	SlyX

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302719	0.814	Voltage-gated potassium channel subunit beta-3
2	9606.ENSP00000295082	0.796	Potassium voltage-gated channel subfamily F member 1
3	9606.ENSP00000373648	0.752	Potassium voltage-gated channel subfamily KQT member 3
4	9606.ENSP00000367323	0.746	Voltage-gated potassium channel subunit beta-2
5	9606.ENSP00000287042	0.736	Potassium voltage-gated channel subfamily S member 2
6	9606.ENSP00000265969	0.727	Potassium voltage-gated channel subfamily C member 1
7	9606.ENSP00000419952	0.727	Voltage-gated potassium channel subunit beta-1
8	9606.ENSP00000358786	0.712	Potassium voltage-gated channel subfamily A member 10
9	9606.ENSP00000262916	0.709	Potassium voltage-gated channel subfamily KQT member 4
10	9606.ENSP00000433109	0.709	Potassium voltage-gated channel subfamily A member 2
11	9606.ENSP00000312129	0.703	Potassium voltage-gated channel subfamily G member 4
12	9606.ENSP00000328511	0.703	Potassium voltage-gated channel subfamily A member 4
13	9606.ENSP00000430846	0.701	Potassium voltage-gated channel subfamily B member 2
14	9606.ENSP00000358802	0.697	Potassium voltage-gated channel subfamily C member 4
15	9606.ENSP00000350681	0.696	ETS domain-containing protein Elk-4
16	9606.ENSP00000221444	0.692	Potassium voltage-gated channel subfamily A member 7
17	9606.ENSP00000352035	0.687	Potassium voltage-gated channel subfamily KQT member 2
18	9606.ENSP00000434241	0.682	Potassium voltage-gated channel subfamily C member 3
19	9606.ENSP00000360806	0.677	Potassium voltage-gated channel subfamily B member 1
20	9606.ENSP00000304127	0.675	Potassium voltage-gated channel subfamily G member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0005249	0.999	voltage-gated potassium channel activity
GO:0005515	0.990	protein binding
GO:1901363	0.820	heterocyclic compound binding
GO:0003690	0.789	double-stranded DNA binding
GO:1990837	0.626	sequence-specific double-stranded DNA binding
GO:0042802	0.385	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.976	regulation of biological process
GO:0050794	0.872	regulation of cellular process
GO:0048519	0.813	negative regulation of biological process
GO:0006810	0.764	transport
GO:0006811	0.744	monoatomic ion transport
GO:0010941	0.738	regulation of cell death
GO:0006812	0.715	monoatomic cation transport
GO:0006813	0.689	potassium ion transport
GO:0048523	0.678	negative regulation of cellular process
GO:0043067	0.673	regulation of programmed cell death
GO:0042981	0.619	regulation of apoptotic process
GO:0060548	0.553	negative regulation of cell death
GO:0009987	0.394	cellular process
GO:0043069	0.359	negative regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.301	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.999	K(+)(in) = K(+)(out)

[back to server]