StarFunc result for job id Q96L58

User Input

>input (329 residues)
MKLLRRAWRRRAALGLGTLALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAAAFLA
VLVASAPRAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLL
LLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLAELRAREPARRRR
LYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVHYLRLSRDYLRAWHS
EDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLC
KREVQLRLSYVYDWSAPPSQCCQRREGIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96L58	1.000	1.000	2.149E-71	329	1.000	1.000	Q96L58.pdb.gz	B3GT6_HUMAN Beta-1,3-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B3GALT6 PE=1 SV=2
2	AFDB:Q91Z92	0.837	0.847	2.270E-58	325	0.778	0.788	Q91Z92.pdb.gz	B3GT6_MOUSE Beta-1,3-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B3galt6 PE=2 SV=1
3	AFDB:Q9N491	0.805	0.803	1.262E-40	330	0.413	0.412	Q9N491.pdb.gz	SQV2_CAEEL Beta-1,3-galactosyltransferase sqv-2 OS=Caenorhabditis elegans OX=6239 GN=sqv-2 PE=2 SV=1
4	AFDB:A1Z7G9	0.753	0.650	3.252E-32	382	0.377	0.325	A1Z7G9.pdb.gz	A1Z7G9_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=beta3GalTII PE=2 SV=1
5	AFDB:Q8RX55	0.676	0.340	8.090E-21	672	0.219	0.107	Q8RX55.pdb.gz	B3GTI_ARATH Hydroxyproline O-galactosyltransferase GALT5 OS=Arabidopsis thaliana OX=3702 GN=GALT5 PE=1 SV=1
6	AFDB:Q8GXG6	0.668	0.334	3.857E-20	673	0.219	0.107	Q8GXG6.pdb.gz	B3GTH_ARATH Hydroxyproline O-galactosyltransferase GALT4 OS=Arabidopsis thaliana OX=3702 GN=GALT4 PE=2 SV=2
7	AFDB:Q9LV16	0.669	0.331	4.106E-20	681	0.213	0.103	Q9LV16.pdb.gz	B3GTJ_ARATH Hydroxyproline O-galactosyltransferase GALT6 OS=Arabidopsis thaliana OX=3702 GN=GALT6 PE=2 SV=2
8	AFDB:F4JIK9	0.679	0.309	5.611E-20	741	0.234	0.104	F4JIK9.pdb.gz	F4JIK9_ARATH Galactosyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
9	AFDB:Q6NQB7	0.549	0.464	9.250E-20	393	0.198	0.165	Q6NQB7.pdb.gz	B3GT7_ARATH Beta-1,3-galactosyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=B3GALT7 PE=2 SV=1
10	AFDB:Q9LM60	0.595	0.497	9.250E-20	398	0.179	0.148	Q9LM60.pdb.gz	B3GT5_ARATH Probable beta-1,3-galactosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=B3GALT5 PE=2 SV=1
11	PDB:7jhiC	0.610	0.606	1.823E-16	331	0.182	0.181	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:6fxrA	0.342	0.183	4.223E-6	700	0.109	0.051	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4y63A	0.313	0.357	1.221E-5	282	0.085	0.099	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
14	PDB:1ll0B	0.302	0.357	4.261E-5	267	0.103	0.127	1ll0B.pdb.gz
15	PDB:7d72A	0.367	0.311	1.158E-4	407	0.100	0.081	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
16	PDB:2d7iA	0.404	0.264	1.232E-4	536	0.125	0.076	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
17	PDB:6b5eB	0.338	0.373	1.232E-4	286	0.112	0.129	6b5eB.pdb.gz	The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.
18	PDB:2xwnB	0.342	0.462	1.397E-4	227	0.109	0.159	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes
19	PDB:7f66J	0.321	0.199	1.487E-4	591	0.085	0.047	7f66J.pdb.gz
20	PDB:8cvzI	0.322	0.384	1.582E-4	267	0.082	0.101	8cvzI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91Z92	0.0	524	325	0.836	0.846	B3GT6_MOUSE Beta-1,3-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B3galt6 PE=2 SV=1
2	Q96L58	0.0	649	329	1.000	1.000	B3GT6_HUMAN Beta-1,3-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B3GALT6 PE=1 SV=2
3	Q9N491	4.78e-82	253	330	0.413	0.412	SQV2_CAEEL Beta-1,3-galactosyltransferase sqv-2 OS=Caenorhabditis elegans OX=6239 GN=sqv-2 PE=2 SV=1
4	A1Z7G9	2.30e-49	171	382	0.310	0.267	A1Z7G9_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=beta3GalTII PE=2 SV=1
5	A7XDQ9	4.39e-23	102	684	0.240	0.115	B3GTK_ARATH Hydroxyproline O-galactosyltransferase GALT2 OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
6	F4JIK9	4.46e-23	102	741	0.240	0.107	F4JIK9_ARATH Galactosyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
7	Q502B3	8.28e-22	97.8	491	0.182	0.122	B3GL2_DANRE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Danio rerio OX=7955 GN=b3galnt2 PE=2 SV=1
8	Q8GXG6	1.84e-21	97.4	673	0.219	0.107	B3GTH_ARATH Hydroxyproline O-galactosyltransferase GALT4 OS=Arabidopsis thaliana OX=3702 GN=GALT4 PE=2 SV=2
9	Q9LV16	1.10e-20	95.1	681	0.222	0.107	B3GTJ_ARATH Hydroxyproline O-galactosyltransferase GALT6 OS=Arabidopsis thaliana OX=3702 GN=GALT6 PE=2 SV=2
10	Q8RX55	2.63e-19	90.9	672	0.231	0.113	B3GTI_ARATH Hydroxyproline O-galactosyltransferase GALT5 OS=Arabidopsis thaliana OX=3702 GN=GALT5 PE=1 SV=1
11	Q9ASW1	2.97e-17	84.7	619	0.216	0.115	B3GTG_ARATH Hydroxyproline O-galactosyltransferase GALT3 OS=Arabidopsis thaliana OX=3702 GN=GALT3 PE=2 SV=1
12	Q9Y2C3	6.11e-17	82.0	310	0.219	0.232	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
13	Q8L7F9	1.26e-16	82.8	643	0.216	0.110	B3GTF_ARATH Beta-1,3-galactosyltransferase GALT1 OS=Arabidopsis thaliana OX=3702 GN=GALT1 PE=1 SV=1
14	Q8NFL0	5.68e-16	80.1	401	0.255	0.209	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
15	A8MRC7	6.74e-16	80.1	407	0.204	0.165	B3GT2_ARATH Probable beta-1,3-galactosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=B3GALT2 PE=2 SV=1
16	Q9Y2A9	1.87e-15	78.6	372	0.204	0.180	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
17	O54904	1.91e-15	78.2	326	0.167	0.169	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
18	Q9Y5Z6	1.91e-15	78.2	326	0.167	0.169	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
19	Q8NCR0	6.44e-15	77.4	500	0.170	0.112	B3GL2_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALNT2 PE=1 SV=1
20	Q94F27	1.38e-14	75.9	338	0.167	0.163	B3GTB_ARATH Hydroxyproline O-galactosyltransferase HPGT1 OS=Arabidopsis thaliana OX=3702 GN=HPTG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01762 Galactosyl_T	5.2e-25	99.9	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368496

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000029410	0.994	Beta-1,4-galactosyltransferase 7
2	9606.ENSP00000265471	0.988	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
3	9606.ENSP00000292377	0.948	Glypican-2
4	9606.ENSP00000307046	0.931	Syndecan-2
5	9606.ENSP00000359864	0.930	Glypican-4
6	9606.ENSP00000368678	0.930	Agrin
7	9606.ENSP00000366267	0.929	Glypican-5
8	9606.ENSP00000264039	0.927	Glypican-1
9	9606.ENSP00000344468	0.926	Syndecan-3
10	9606.ENSP00000377836	0.925	Glypican-3
11	9606.ENSP00000366246	0.924	Glypican-6
12	9606.ENSP00000052754	0.919	Decorin
13	9606.ENSP00000363827	0.919	Basement membrane-specific heparan sulfate proteoglycan core protein
14	9606.ENSP00000361818	0.917	Syndecan-4
15	9606.ENSP00000370542	0.916	Syndecan-1
16	9606.ENSP00000327336	0.915	Biglycan
17	9606.ENSP00000265077	0.914	Versican core protein
18	9606.ENSP00000331210	0.910	Brevican core protein
19	9606.ENSP00000252575	0.908	Neurocan core protein
20	9606.ENSP00000373244	0.901	Chondroitin sulfate proteoglycan 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140103	1.000	catalytic activity, acting on a glycoprotein
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0047220	0.694	galactosylxylosylprotein 3-beta-galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0030203	0.996	glycosaminoglycan metabolic process
GO:0006023	0.995	aminoglycan biosynthetic process
GO:0006024	0.994	glycosaminoglycan biosynthetic process
GO:0009101	0.992	glycoprotein biosynthetic process
GO:0006029	0.976	proteoglycan metabolic process
GO:0030166	0.936	proteoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0031090	0.996	organelle membrane
GO:0031984	0.995	organelle subcompartment
GO:0005797	0.992	Golgi medial cisterna
GO:0000139	0.970	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:11780	0.694	3-O-(beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + UDP-alpha-D-galactose = 3-O-(beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.134	0.694	galactosylxylosylprotein 3-beta-galactosyltransferase.

[back to server]