StarFunc result for job id Q96L73

User Input

>input (2696 residues)
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNA
YGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQTPIVCTSLSPGG
PTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQ
RNEVDGSNEKAALLPAPFSLGDTNITIEEQLNSINLSFQDDPDSSTSTLGNMLELPGTSS
SSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSK
WEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTNDPESEHDLLLNGCLKSLA
FDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALIS
KCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDN
SVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHS
KSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSPLASISKSGKVDGLKLLN
NMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGG
STHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKRDLPASGKSRSDCVTRRN
CGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSV
MNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSECAFRVLLPSDPVQEGR
DEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPAVRSEKKRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEEESLLAR
GRSSAQNKQVDENSLISTKEEPPVLEREAPFLEGPLAQSELGGGHAELPQLTLSVPVAPE
VSPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGH
LENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEG
ELMPHRTATSPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEA
QCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECV
QKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSK
ILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPE
GNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFG
SNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQED
RKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYEC
HPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEE
CRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRV
GLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFK
KKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECP
WHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIRE
YVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPE
RPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRPQLSDKPSPVTSPS
SSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKP
QTSDRPTDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLID
LTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGCVSDPLQTSGKAA
APSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQA
KQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIV
AGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSSHKCAESEQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8JIA4	0.195	0.338	0.000	1461	0.223	0.411	B8JIA4.pdb.gz	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
2	AFDB:O88491	0.265	0.274	0.000	2588	0.795	0.828	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
3	AFDB:Q96L73	1.000	1.000	0.000	2696	1.000	1.000	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
4	AFDB:Q9BYW2	0.083	0.087	1.527E-32	2564	0.156	0.164	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
5	AFDB:E9Q5F9	0.083	0.088	5.098E-31	2537	0.155	0.165	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
6	AFDB:Q2LAE1	0.085	0.128	1.336E-28	1759	0.116	0.177	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
7	AFDB:Q9VW15	0.091	0.109	5.056E-22	2226	0.122	0.148	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
8	AFDB:Q9VYD1	0.084	0.097	4.266E-19	2313	0.099	0.116	Q9VYD1.pdb.gz	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
9	PDB:5hynA	0.060	0.269	1.018E-14	581	0.020	0.095	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
10	PDB:7td5F	0.057	0.324	2.347E-14	447	0.020	0.119	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
11	PDB:7ksoA	0.057	0.374	2.481E-14	395	0.021	0.142	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
12	PDB:7td5A	0.055	0.290	2.623E-14	497	0.019	0.105	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
13	PDB:5wg6A	0.056	0.280	8.931E-14	517	0.019	0.101	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
14	AFDB:Q8IE95	0.087	0.092	1.246E-13	2548	0.122	0.129	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1
15	PDB:6wkrC	0.058	0.252	1.559E-13	606	0.020	0.091	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
16	AFDB:Q8IRW8	0.067	0.072	5.605E-13	2431	0.131	0.146	Q8IRW8.pdb.gz	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
17	PDB:1pegA	0.069	0.609	3.726E-12	266	0.027	0.271	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:5h6zA	0.038	0.688	6.705E-5	123	0.008	0.171	5h6zA.pdb.gz
19	PDB:2g46A	0.035	0.632	2.159E-4	119	0.008	0.176	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:3qxyA	0.036	0.193	4.453E-4	420	0.009	0.060	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JIA4	0.0	944	1461	0.156	0.287	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
2	O88491	0.0	3703	2588	0.698	0.727	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
3	O96028	0.0	1028	1365	0.168	0.332	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
4	Q6P2L6	0.0	917	1439	0.159	0.297	NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2
5	Q8BVE8	0.0	1029	1365	0.168	0.332	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
6	Q96L73	0.0	5565	2696	1.000	1.000	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
7	Q9BZ95	0.0	949	1437	0.174	0.326	NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1
8	Q8MT36	2.51e-127	441	1427	0.085	0.160	NSD_DROME Nuclear receptor binding SET domain protein OS=Drosophila melanogaster OX=7227 GN=NSD PE=1 SV=2
9	Q2LAE1	1.09e-50	201	1759	0.035	0.054	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
10	Q9NR48	2.32e-49	197	2969	0.040	0.036	ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens OX=9606 GN=ASH1L PE=1 SV=2
11	Q99MY8	5.05e-49	196	2958	0.038	0.034	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3
12	Q55FF7	1.74e-48	191	898	0.034	0.102	Q55FF7_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268132 PE=4 SV=1
13	A0A8I6A5I9	5.31e-48	193	2526	0.035	0.038	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
14	A0A8I6AUV5	5.60e-48	193	2426	0.035	0.039	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
15	A0A8I5ZLS2	5.88e-48	193	2419	0.035	0.039	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
16	A0A0G2KB10	6.12e-48	193	2523	0.035	0.038	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
17	A0A8I6A709	6.65e-48	192	2520	0.035	0.038	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
18	D4A5H6	7.26e-48	192	2294	0.035	0.041	D4A5H6_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=2
19	E9Q5F9	7.33e-48	192	2537	0.035	0.037	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
20	Q9BYW2	9.81e-48	192	2564	0.035	0.037	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17907 AWS	1.1e-12	59.0	AWS domain
2	PF17982 C5HCH	6.9e-16	69.5	NSD Cys-His rich domain
3	PF00628 PHD	6e-09	47.0	PHD-finger
4	PF13831 PHD_2	0.22	22.3	PHD-finger
5	PF00855 PWWP	1e-27	107.8	PWWP domain
6	PF00856 SET	1e-17	76.5	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316032	0.877	Nuclear pore complex protein Nup98-Nup96
2	9606.ENSP00000254066	0.869	Retinoic acid receptor alpha
3	9606.ENSP00000432786	0.869	Lysine-specific demethylase 2A
4	9606.ENSP00000443017	0.834	Histone cluster 4, H4
5	9606.ENSP00000294753	0.829	Zinc finger protein 496
6	9606.ENSP00000196061	0.795	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
7	9606.ENSP00000363822	0.773	Androgen receptor
8	9606.ENSP00000367755	0.760	Calmodulin-lysine N-methyltransferase
9	9606.ENSP00000436786	0.752	Histone-lysine N-methyltransferase 2A
10	9606.ENSP00000334181	0.739	Lysine-specific demethylase 4D
11	9606.ENSP00000382688	0.725	Lysine-specific demethylase 5A
12	9606.ENSP00000274031	0.723	Histone-lysine N-methyltransferase SETD7
13	9606.ENSP00000244537	0.718	Histone cluster 1 H4 family member f
14	9606.ENSP00000316578	0.708	Polycomb protein SUZ12
15	9606.ENSP00000340648	0.698	E3 ubiquitin-protein ligase HUWE1
16	9606.ENSP00000381657	0.690	Histone-lysine N-methyltransferase, H3 lysine-79 specific
17	9606.ENSP00000369666	0.687	F-box/LRR-repeat protein 19
18	9606.ENSP00000405330	0.685	Estrogen receptor
19	9606.ENSP00000476960	0.684	Histone cluster 2 H3 pseudogene 2
20	9606.ENSP00000467024	0.675	UV excision repair protein RAD23 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0008134	0.998	transcription factor binding
GO:0140110	0.997	transcription regulator activity
GO:0046975	0.997	histone H3K36 methyltransferase activity
GO:0000977	0.989	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0043167	0.985	ion binding
GO:0003712	0.979	transcription coregulator activity
GO:0140297	0.978	DNA-binding transcription factor binding
GO:0061629	0.967	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0046872	0.936	metal ion binding
GO:0050681	0.936	nuclear androgen receptor binding
GO:0008270	0.934	zinc ion binding
GO:0000987	0.930	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.919	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.749	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0010604	0.982	positive regulation of macromolecule metabolic process
GO:0051173	0.980	positive regulation of nitrogen compound metabolic process
GO:0048522	0.979	positive regulation of cellular process
GO:2001141	0.976	regulation of RNA biosynthetic process
GO:1903506	0.963	regulation of nucleic acid-templated transcription
GO:0031325	0.958	positive regulation of cellular metabolic process
GO:0010468	0.957	regulation of gene expression
GO:0006355	0.953	regulation of DNA-templated transcription
GO:0031399	0.924	regulation of protein modification process
GO:0065009	0.917	regulation of molecular function
GO:0045935	0.899	positive regulation of nucleobase-containing compound metabolic process
GO:0051174	0.864	regulation of phosphorus metabolic process
GO:0051098	0.792	regulation of binding
GO:0009987	0.781	cellular process
GO:0045893	0.746	positive regulation of DNA-templated transcription
GO:0019220	0.723	regulation of phosphate metabolic process
GO:0051101	0.714	regulation of DNA binding
GO:0042325	0.713	regulation of phosphorylation
GO:0001932	0.699	regulation of protein phosphorylation
GO:2000677	0.688	regulation of transcription regulatory region DNA binding
GO:0033135	0.684	regulation of peptidyl-serine phosphorylation
GO:0071704	0.493	organic substance metabolic process
GO:0043170	0.436	macromolecule metabolic process
GO:0048519	0.412	negative regulation of biological process
GO:0044238	0.376	primary metabolic process
GO:0006807	0.368	nitrogen compound metabolic process
GO:0048523	0.333	negative regulation of cellular process
GO:0044237	0.323	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.919	protein-containing complex
GO:0005737	0.673	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	0.999	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]