StarFunc result for job id Q96L91

User Input

>input (1400 residues)
MHHGTGPQNVQHQLQRSRACPGSEGEEQPAHPNPPPSPAAPFAPSASPSAPQSPSYQIQQ
LMNRSPATGQNVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSY
IQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQI
SLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQ
SPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGV
LLPGAGGAAGFGMTSPPPPTSPSRTAVPPGLSSLPLTSVGNTGMKKVPKKLEEIPPASPE
MAQMRKQCLDYHYQEMQALKEVFKEYLIELFFLQHFQGNMMDFLAFKKKHYAPLQAYLRQ
NDLDIEEEEEEEEEEEEKSEVINDEVKVVTGKDGQTGTPVAIATQLPPKVSAAFSSQQQP
FQQALAGSLVAGAGSTVETDLFKRQQAMPSTGMAEQSKRPRLEVGHQGVVFQHPGADAGV
PLQQLMPTAQGGMPPTPQAAQLAGQRQSQQQYDPSTGPPVQNAASLHTPLPQLPGRLPPA
GVPTAALSSALQFAQQPQVVEAQTQLQIPVKTQQPNVPIPAPPSSQLPIPPSQPAQLALH
VPTPGKVQVQASQLSSLPQMVASTRLPVDPAPPCPRPLPTSSTSSLAPVSGSGPGPSPAR
SSPVNRPSSATNKALSPVTSRTPGVVASAPTKPQSPAQNATSSQDSSQDTLTEQITLENQ
VHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKL
VRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQVVEIKLRVELEEKR
KKALNLQKVSRRGKELRPKGFDALQESSLDSGMSGRKRKASISLTDDEVDDEEETIEEEE
ANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEEDADDCP
GDRESRKDLVLIDSLFIMDQFKAAERMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVK
FNAPSLLYGALRDYQKIGLDWLAKLYRKNLNGILADEAGLGKTVQIIAFFAHLACNEGNW
GPHLVVVRSCNILKWELELKRWCPGLKILSYIGSHRELKAKRQEWAEPNSFHVCITSYTQ
FFRGLTAFTRVRWKCLVIDEMQRVKGMTERHWEAVFTLQSQQRLLLIDSPLHNTFLELWT
MVHFLVPGISRPYLSSPLRAPSEESQDYYHKVVIRLHRVTQPFILRRTKRDVEKQLTKKY
EHVLKCRLSNRQKALYEDVILQPGTQEALKSGHFVNVLSILVRLQRICNHPGLVEPRHPG
SSYVAGPLEYPSASLILKAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MR80	0.134	0.177	1.300E-96	985	0.699	0.994	A0A0A0MR80.pdb.gz	A0A0A0MR80_HUMAN E1A binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=1
2	AFDB:O14148	0.205	0.181	1.397E-27	1604	0.184	0.161	O14148.pdb.gz	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
3	PDB:6gejM	0.200	0.395	6.527E-25	688	0.096	0.196	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
4	PDB:7epuB	0.156	0.283	1.468E-18	748	0.067	0.126	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
5	PDB:6g0lM	0.177	0.284	1.832E-18	855	0.071	0.117	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
6	PDB:6g0lW	0.187	0.291	1.205E-17	878	0.077	0.123	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
7	PDB:6tdaS	0.190	0.330	1.590E-17	783	0.074	0.132	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:6uxwA	0.191	0.332	1.878E-17	778	0.097	0.175	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
9	PDB:6jylK	0.188	0.500	1.820E-16	504	0.071	0.198	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
10	PDB:7oo3b	0.186	0.455	3.167E-16	534	0.064	0.167	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
11	PDB:6kw3Y	0.191	0.451	5.970E-15	548	0.069	0.177	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
12	PDB:5vvrM	0.174	0.445	1.484E-13	503	0.065	0.181	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
13	AFDB:Q9VED3	0.039	0.042	2.885E-4	1186	0.110	0.130	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
14	AFDB:Q80TN7	0.088	0.062	4.023E-4	2359	0.150	0.089	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
15	AFDB:Q8NEY1	0.070	0.056	1.699E-3	1877	0.156	0.117	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
16	AFDB:M9PHB1	0.057	0.069	4.605E-3	1100	0.104	0.132	M9PHB1.pdb.gz	M9PHB1_DROME Ensconsin, isoform G OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
17	AFDB:Q9FM57	0.065	0.052	8.471E-3	1826	0.123	0.094	Q9FM57.pdb.gz	Q9FM57_ARATH Inner centromere protein, ARK-binding region protein OS=Arabidopsis thaliana OX=3702 GN=WYR PE=1 SV=1
18	AFDB:P29617	0.043	0.038	1.117E-2	1703	0.111	0.091	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
19	AFDB:Q9CAC4	0.063	0.095	1.558E-2	749	0.069	0.130	Q9CAC4.pdb.gz	MYOB2_ARATH Myosin-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MYOB2 PE=1 SV=1
20	AFDB:O60293	0.048	0.042	1.840E-2	1989	0.122	0.086	O60293.pdb.gz	ZC3H1_HUMAN Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MR80	0.0	1950	985	0.699	0.994	A0A0A0MR80_HUMAN E1A binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=1
2	A0A0G2JU09	0.0	2276	3152	0.859	0.381	A0A0G2JU09_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
3	A0A8I5ZTE5	0.0	2088	2998	0.806	0.376	A0A8I5ZTE5_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
4	A0A8I6G935	0.0	2221	3146	0.839	0.373	A0A8I6G935_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
5	D3ZQ89	0.0	2189	3034	0.834	0.385	D3ZQ89_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
6	Q8CHI8	0.0	2275	3072	0.857	0.391	EP400_MOUSE E1A-binding protein p400 OS=Mus musculus OX=10090 GN=Ep400 PE=1 SV=3
7	Q96L91	0.0	2867	3159	1.000	0.443	EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=4
8	Q9NEL2	1.61e-129	446	2395	0.173	0.101	SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4
9	Q6ZRS2	1.07e-116	408	3230	0.126	0.054	SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3
10	Q9NDJ2	5.27e-110	388	3198	0.135	0.059	DOM_DROME Helicase domino OS=Drosophila melanogaster OX=7227 GN=dom PE=1 SV=2
11	Q7X9V2	2.70e-97	348	2055	0.138	0.094	PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana OX=3702 GN=PIE1 PE=1 SV=1
12	Q05471	3.90e-84	306	1514	0.109	0.101	SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWR1 PE=1 SV=1
13	O13682	4.28e-83	301	1288	0.105	0.114	SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swr1 PE=3 SV=1
14	Q383K6	3.27e-72	267	1211	0.091	0.105	Q383K6_TRYB2 SNF2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2500 PE=4 SV=1
15	Q9VDY1	9.05e-59	226	1638	0.085	0.073	INO80_DROME Chromatin-remodeling ATPase INO80 OS=Drosophila melanogaster OX=7227 GN=Ino80 PE=1 SV=2
16	Q9ULG1	6.26e-58	223	1556	0.079	0.071	INO80_HUMAN Chromatin-remodeling ATPase INO80 OS=Homo sapiens OX=9606 GN=INO80 PE=1 SV=2
17	Q6ZPV2	1.13e-57	222	1559	0.079	0.071	INO80_MOUSE Chromatin-remodeling ATPase INO80 OS=Mus musculus OX=10090 GN=Ino80 PE=1 SV=2
18	F4J277	5.79e-57	219	1540	0.089	0.081	F4J277_ARATH Chromatin-remodeling ATPase INO80 OS=Arabidopsis thaliana OX=3702 GN=INO80 PE=1 SV=1
19	O14148	3.16e-56	218	1604	0.075	0.065	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
20	F4JAV9	7.76e-54	208	1057	0.082	0.109	F4JAV9_ARATH Chromatin-remodeling protein 11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15790 EP400_N	4.7e-267	898.2	E1A-binding protein p400, N-terminal
2	PF07529 HSA	7.7e-16	69.5	HSA domain
3	PF04851 ResIII	1.2	20.6	Type III restriction enzyme, res subunit
4	PF00176 SNF2-rel_dom	2.6e-43	159.8	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000005585

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002893	0.987	Uncharacterized protein
2	9593.ENSGGOP00000003226	0.985	K(lysine) acetyltransferase 5
3	9593.ENSGGOP00000003486	0.967	DNA methyltransferase 1 associated protein 1
4	9593.ENSGGOP00000009039	0.958	RuvB-like helicase
5	9593.ENSGGOP00000010264	0.939	RuvB-like helicase
6	9593.ENSGGOP00000023360	0.931	YEATS domain containing 4
7	9593.ENSGGOP00000010106	0.925	Uncharacterized protein
8	9593.ENSGGOP00000015328	0.924	Actin-like 6A
9	9593.ENSGGOP00000016894	0.919	Mortality factor 4 like 1
10	9593.ENSGGOP00000016610	0.912	MRG/MORF4L binding protein
11	9593.ENSGGOP00000006949	0.906	Bromodomain containing 8
12	9593.ENSGGOP00000028329	0.887	Mortality factor 4 like 2
13	9593.ENSGGOP00000016303	0.882	Zinc finger, HIT-type containing 1
14	9593.ENSGGOP00000016777	0.880	MYST/Esa1-associated factor 6
15	9593.ENSGGOP00000001321	0.870	Craniofacial development protein 1
16	9593.ENSGGOP00000000842	0.865	ARP6 actin-related protein 6 homolog (yeast)
17	9593.ENSGGOP00000007911	0.861	Enhancer of polycomb homolog 1 (Drosophila)
18	9593.ENSGGOP00000008032	0.844	E1A binding protein p300
19	9593.ENSGGOP00000016100	0.835	Actin-like 6B
20	9593.ENSGGOP00000000508	0.828	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.314	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016570	0.974	histone modification
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0050794	0.952	regulation of cellular process
GO:0018205	0.947	peptidyl-lysine modification
GO:0019219	0.935	regulation of nucleobase-containing compound metabolic process
GO:0016573	0.933	histone acetylation
GO:0045935	0.920	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.915	positive regulation of macromolecule metabolic process
GO:2001020	0.912	regulation of response to DNA damage stimulus
GO:0043967	0.893	histone H4 acetylation
GO:0051054	0.880	positive regulation of DNA metabolic process
GO:0000018	0.877	regulation of DNA recombination
GO:0006282	0.867	regulation of DNA repair
GO:2000779	0.813	regulation of double-strand break repair
GO:2001022	0.726	positive regulation of response to DNA damage stimulus
GO:0010569	0.721	regulation of double-strand break repair via homologous recombination
GO:0045911	0.721	positive regulation of DNA recombination
GO:2000781	0.720	positive regulation of double-strand break repair
GO:0009987	0.588	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.677	intracellular organelle lumen
GO:0031981	0.638	nuclear lumen
GO:0005654	0.625	nucleoplasm
GO:0043228	0.435	non-membrane-bounded organelle
GO:0043232	0.434	intracellular non-membrane-bounded organelle
GO:0032991	0.379	protein-containing complex
GO:1902494	0.339	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]