StarFunc result for job id Q96L93

User Input

>input (1317 residues)
MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDF
SFYSADTKSPDYVSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSG
LIPRICEGLFSRINETTRWDEASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKE
GPYVEDLSKHLVQNYGDVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDSEM
PCETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALADLSQDAANTL
AKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIIN
KPTINEDANVKLIRELRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVQELTK
EWTNKWNETQNILKEQTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYV
GRDDASTEQDIVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVNGVQIVEATHLNQGAV
ILLGRTNMFRFNHPKEAAKLREKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFER
QQREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKR
RSFHIENKLKDLLAEKEKFEEERLREQQEIELQKKRQEEETFLRVQEELQRLKELNNNEK
AEKFQIFQELDQLQKEKDEQYAKLELEKKRLEEQEKEQVMLVAHLEEQLREKQEMIQLLR
RGEVQWVEEEKRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRFFEFKRRQLVKLVNLE
KDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEY
RLQYKERQLQYLLQNHLPTLLEEKQRAFEILDRGPLSLDNTLYQVEKEMEEKEEQLAQYQ
ANANQLQKLQATFEFTANIARQEEKVRKKEKEILESREKQQREALERALARLERRHSALQ
RHSTLGMEIEEQRQKLASLNSGSREQSGLQASLEAEQEALEKDQERLEYEIQQLKQKIYE
VDGVQKDHHGTLEGKVASSSLPVSAEKSHLVPLMDARINAYIEEEVQRRLQDLHRVISEG
CSTSADTMKDNEKLHNGTIQRKLKYERMVSRSLGANPDDLKDPIKISIPRYVLCGQGKDA
HFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAER
RSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AVY7	0.517	0.518	0.000	1312	0.858	0.861	B1AVY7.pdb.gz	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
2	AFDB:Q96L93	1.000	1.000	0.000	1317	1.000	1.000	Q96L93.pdb.gz	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
3	AFDB:A1ZAJ2	0.297	0.236	6.784E-66	1670	0.227	0.179	A1ZAJ2.pdb.gz	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
4	AFDB:F1QBV5	0.263	0.196	1.059E-63	1770	0.243	0.181	F1QBV5.pdb.gz	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
5	AFDB:O60333	0.295	0.216	1.843E-62	1816	0.242	0.176	O60333.pdb.gz	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
6	AFDB:F1M4A4	0.266	0.206	2.041E-62	1707	0.241	0.186	F1M4A4.pdb.gz	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
7	AFDB:F1QJ64	0.261	0.295	4.387E-62	1161	0.240	0.272	F1QJ64.pdb.gz	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
8	AFDB:O43896	0.261	0.311	3.880E-59	1103	0.229	0.273	O43896.pdb.gz	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
9	AFDB:A0A0G2K8Z9	0.267	0.191	2.089E-58	1843	0.230	0.164	A0A0G2K8Z9.pdb.gz	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
10	AFDB:Q15058	0.270	0.219	2.314E-58	1648	0.274	0.219	Q15058.pdb.gz	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
11	PDB:7wrgA	0.248	0.397	2.571E-45	812	0.165	0.267	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.236	0.392	1.241E-43	783	0.157	0.264	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.209	0.400	1.307E-21	670	0.083	0.163	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:2ff4A	0.069	0.228	1.865E-6	379	0.036	0.127	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:2kb3A	0.067	0.560	2.497E-4	143	0.015	0.140	2kb3A.pdb.gz
16	PDB:2mxcA	0.067	0.455	1.096E-3	172	0.018	0.140	2mxcA.pdb.gz
17	PDB:7z8fe	0.053	0.020	5.904E-3	4579	0.045	0.013	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
18	PDB:2dybA	0.075	0.299	2.008E-2	298	0.018	0.081	2dybA.pdb.gz
19	PDB:2kfuA	0.064	0.435	2.728E-2	162	0.015	0.123	2kfuA.pdb.gz
20	PDB:3upuA	0.056	0.115	1.081E-1	439	0.034	0.103	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AVY7	0.0	2176	1312	0.856	0.860	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
2	Q96L93	0.0	2689	1317	1.000	1.000	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
3	Q9P2P6	0.0	604	4700	0.237	0.066	STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens OX=9606 GN=STARD9 PE=1 SV=3
4	Q9VB25	0.0	671	1265	0.278	0.289	KL98A_DROME Kinesin-like protein Klp98A OS=Drosophila melanogaster OX=7227 GN=Klp98A PE=1 SV=2
5	F1QJ64	1.26e-174	551	1161	0.233	0.264	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
6	A1ZAJ2	4.84e-172	557	1670	0.239	0.189	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
7	E9QDE5	7.67e-169	550	1763	0.233	0.174	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
8	F1QBV5	9.47e-169	550	1770	0.233	0.173	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
9	P33173	2.74e-168	547	1695	0.232	0.181	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
10	A0A8I6A6V5	3.14e-168	547	1697	0.232	0.180	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
11	Q12756	9.89e-168	546	1690	0.231	0.180	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
12	F1M4A4	4.09e-167	545	1707	0.232	0.179	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
13	Q9NGQ2	5.23e-164	543	2205	0.225	0.134	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
14	O35071	3.92e-162	516	1100	0.234	0.280	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
15	O43896	4.01e-162	516	1103	0.220	0.263	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
16	Q5AVY3	1.22e-157	517	1630	0.216	0.174	Q5AVY3_EMENI Kinesin family protein (AFU_orthologue AFUA_2G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uncA PE=3 SV=1
17	O35787	2.23e-156	501	1097	0.217	0.261	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
18	P23678	2.07e-150	496	1584	0.226	0.188	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
19	Q15058	2.91e-149	494	1648	0.228	0.182	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
20	Q9NQT8	5.92e-147	491	1826	0.209	0.151	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.044	25.5	FHA domain
2	PF00225 Kinesin	4.3e-110	379.4	Kinesin motor domain
3	PF16183 Kinesin_assoc	0.00026	32.7	Kinesin-associated
4	PF16796 Microtub_bd	2.8e-19	81.0	Microtubule binding
5	PF00787 PX	1.2e-08	46.9	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000040051

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000009370	0.756	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
2	9598.ENSPTRP00000051348	0.732	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
3	9598.ENSPTRP00000002773	0.718	Kinesin-associated protein 3
4	9598.ENSPTRP00000030982	0.708	Kinesin-like protein
5	9598.ENSPTRP00000053686	0.695	Transmembrane phosphoinositide 3-phosphatase and tensin homolog 2
6	9598.ENSPTRP00000044097	0.678	Uncharacterized protein
7	9598.ENSPTRP00000011536	0.669	Uncharacterized protein
8	9598.ENSPTRP00000020737	0.649	Uncharacterized protein
9	9598.ENSPTRP00000008406	0.624	Rac GTPase activating protein 1
10	9598.ENSPTRP00000031077	0.624	Uncharacterized protein
11	9598.ENSPTRP00000046464	0.607	Kinesin-like protein
12	9598.ENSPTRP00000004812	0.603	Kinesin family member 11
13	9598.ENSPTRP00000029552	0.601	Kinesin-like protein
14	9598.ENSPTRP00000007646	0.600	Rho GTPase activating protein 32
15	9598.ENSPTRP00000020780	0.600	Chromosome 2 open reading frame 3
16	9598.ENSPTRP00000020217	0.599	Keratinocyte associated protein 3
17	9598.ENSPTRP00000046636	0.592	Taspase, threonine aspartase, 1
18	9598.ENSPTRP00000008740	0.591	Uncharacterized protein
19	9598.ENSPTRP00000044771	0.589	Uncharacterized protein
20	9598.ENSPTRP00000052065	0.589	CAP-GLY domain containing linker protein family, member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	0.999	microtubule motor activity
GO:0035091	0.997	phosphatidylinositol binding
GO:1901981	0.992	phosphatidylinositol phosphate binding
GO:0043168	0.990	anion binding
GO:0032266	0.977	phosphatidylinositol-3-phosphate binding
GO:1902936	0.976	phosphatidylinositol bisphosphate binding
GO:0080025	0.948	phosphatidylinositol-3,5-bisphosphate binding
GO:0008574	0.931	plus-end-directed microtubule motor activity
GO:0019899	0.890	enzyme binding
GO:0043325	0.783	phosphatidylinositol-3,4-bisphosphate binding
GO:0005547	0.616	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0008092	0.367	cytoskeletal protein binding
GO:0003824	0.335	catalytic activity
GO:0016787	0.310	hydrolase activity
GO:0051020	0.309	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.985	biological regulation
GO:0050789	0.976	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0051179	0.966	localization
GO:0051641	0.952	cellular localization
GO:0051234	0.921	establishment of localization
GO:0051649	0.905	establishment of localization in cell
GO:0006810	0.876	transport
GO:0046907	0.841	intracellular transport
GO:0071704	0.736	organic substance metabolic process
GO:0050896	0.717	response to stimulus
GO:0016192	0.700	vesicle-mediated transport
GO:0051716	0.597	cellular response to stimulus
GO:0071840	0.551	cellular component organization or biogenesis
GO:0007154	0.521	cell communication
GO:0023052	0.517	signaling
GO:0007166	0.498	cell surface receptor signaling pathway
GO:0016043	0.452	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.991	endomembrane system
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0031410	0.987	cytoplasmic vesicle
GO:0005829	0.949	cytosol
GO:0015630	0.874	microtubule cytoskeleton
GO:0016020	0.865	membrane
GO:0005819	0.823	spindle
GO:0005768	0.428	endosome
GO:0005769	0.414	early endosome
GO:0032991	0.333	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.3	0.931	plus-end-directed kinesin ATPase.
EC:3.-.-.-	0.310	Hydrolases.

[back to server]