StarFunc result for job id Q96L96

User Input

>input (1907 residues)
MEVAWLVYVLGQQPLARQGEGQSRLVPGRGLVLWLPGLPRSSPSWPAVDLAPLAPARPRG
PLICHTGHEQAGREPGPGSSTKGPVLHDQDTRCAFLPRPPGPLQTRRYCRHQGRQGSGLG
AGPGAGTWAPAPPGVSKPRCPGRARPGEGQQQVTTARPPAINRGARQPRAGAAAAGRGPG
AGAWRTGEAAASAGPAVGEGGAMGSRRAPSRGWGAGGRSGAGGDGEDDGPVWIPSPASRS
YLLSVRPETSLSSNRLSHPSSGRSTFCSIIAQLTEETQPLFETTLKSRSVSEDSDVRFTC
IVTGYPEPEVTWYKDDTELDRYCGLPKYEITHQGNRHTLQLYRCREEDAAIYQASAQNSK
GIVSCSGVLEVGTMTEYKIHQRWFAKLKRKAAAKLREIEQSWKHEKAVPGEVDTLRKLSP
DRFQRKRRLSGAQAPGPSVPTREPEGGTLAAWQEGETETAQHSGLGLINSFASGEVTTNG
EAAPENGEDGEHGLLTYICDAMELGPQRALKEESGAKKKKKDEESKQGLRKPELEKAAQS
RRSSENCIPSSDEPDSCGTQGPVGVEQVQTQPRGRAARGPGSSGTDSTRKPASAVGTPDK
AQKAPGPGPGQEVYFSLKDMYLENTQAVRPLGEEGPQTLSVRAPGESPKGKAPLRARSEG
VPGAPGQPTHSLTPQPTRPFNRKRFAPPKPKGEATTDSKPISSLSQAPECGAQSLGKAPP
QASVQVPTPPARRRHGTRDSTLQGQAGHRTPGEVLECQTTTAPTMSASSSSDVASIGVST
SGSQGIIEPMDMETQEDGRTSANQRTGSKKNVQADGKIQVDGRTRGDGTQTAQRTRADRK
TQVDAGTQESKRPQSDRSAQKGMMTQGRAETQLETTQAGEKIQEDRKAQADKGTQEDRRM
QGEKGMQGEKGTQSEGSAPTAMEGQSEQEVATSLGPPSRTPKLPPTAGPRAPLNIECFVQ
TPEGSCFPKKPGCLPRSEEAVVTASRNHEQTVLGPLSGNLMLPAQPPHEGSVEQVGGERC
RGPQSSGPVEAKQEDSPFQCPKEERPGGVPCMDQGGCPLAGLSQEVPTMPSLPGTGLTAS
PKAGPCSTPTSQHGSTATFLPSEDQVLMSSAPTLHLGLGTPTQSHPPETMATSSEGACAQ
VPDVEGRTPGPRSCDPGLIDSLKNYLLLLLKLSSTETSGAGGESQVGAATGGLVPSATLT
PTVEVAGLSPRTSRRILERVENNHLVQSAQTLLLSPCTSRRLTGLLDREVQAGRQALAAA
RGSWGPGPSSLTVPAIVVDEEDPGLASEGASEGEGEVSPEGPGLLGASQESSMAGRLGEA
GGQAAPGQGPSAESIAQEPSQEEKFPGEALTGLPAATPEELALGARRKRFLPKVRAAGDG
EATTPEERESPTVSPRGPRKSLVPGSPGTPGRERRSPTQGRKASMLEVPRAEEELAAGDL
GPSPKAGGLDTEVALDEGKQETLAKPRKAKDLLKAPQVIRKIRVEQFPDASGSLKLWCQF
FNILSDSVLTWAKDQRPVGEVGRSAGDEGPAALAIVQASPVDCGVYRCTIHNEHGSASTD
FCLSPEVLSGFISREEGEVGEEIEMTPMVFAKGLADSGCWGDKLFGRLVSEELRGGGYGC
GLRKASQAKVIYGLEPIFESGRTCIIKVSSLLVFGPSSETSLVGRNYDVTIQGCKIQNMS
REYCKIFAAEARAAPGFGEVPEIIPLYLIYRPANNIPYATLEEDLGKPLESYCSREWGCA
EAPTASGSSEAMQKCQTFQHWLYQWTNGSFLVTDLAGVDWKMTDVQIATKLRGYQGLKES
CFPALLDRFASSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQK
KGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGMR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q924C5	0.323	0.360	0.000	1678	0.640	0.728	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
2	AFDB:Q86TB3	0.186	0.164	2.142E-42	2170	0.238	0.209	Q86TB3.pdb.gz	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
3	AFDB:F1QU13	0.126	0.123	3.461E-37	1966	0.170	0.165	F1QU13.pdb.gz	ALPK2_DANRE Alpha-protein kinase 2 OS=Danio rerio OX=7955 GN=alpk2 PE=2 SV=2
4	AFDB:Q90X22	0.063	0.089	1.826E-17	1276	0.105	0.158	Q90X22.pdb.gz
5	AFDB:Q3V1M1	0.043	0.031	3.213E-10	2594	0.107	0.079	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
6	AFDB:Q6WRI0	0.054	0.042	3.179E-9	2623	0.098	0.071	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
7	AFDB:Q9VZT8	0.052	0.068	1.326E-7	1443	0.097	0.128	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
8	AFDB:Q6WRH9	0.045	0.033	2.032E-7	2597	0.108	0.079	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
9	PDB:6sm1A	0.044	0.634	2.547E-6	111	0.012	0.198	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
10	PDB:4aizA	0.044	0.661	7.011E-6	107	0.013	0.234	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
11	PDB:2cd0A	0.044	0.651	1.645E-5	111	0.011	0.189	2cd0A.pdb.gz
12	PDB:5ir3A	0.046	0.665	2.658E-5	111	0.013	0.225	5ir3A.pdb.gz
13	PDB:4edqA	0.049	0.182	2.803E-5	483	0.012	0.048	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
14	PDB:1cd0A	0.043	0.619	2.957E-5	111	0.011	0.189	1cd0A.pdb.gz
15	PDB:5c6wJ	0.044	0.307	3.659E-5	238	0.011	0.088	5c6wJ.pdb.gz
16	PDB:4m62L	0.047	0.658	9.056E-5	113	0.010	0.177	4m62L.pdb.gz
17	AFDB:A0A338P6S8	0.050	0.057	1.218E-4	1637	0.120	0.140	A0A338P6S8.pdb.gz	A0A338P6S8_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
18	PDB:1jv5A	0.045	0.697	1.387E-4	107	0.012	0.206	1jv5A.pdb.gz
19	PDB:2q20B	0.048	0.676	1.463E-4	109	0.010	0.174	2q20B.pdb.gz
20	AFDB:B7YZF2	0.042	0.047	2.858E-4	1633	0.101	0.118	B7YZF2.pdb.gz	B7YZF2_DROME Shavenoid, isoform B OS=Drosophila melanogaster OX=7227 GN=sha PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q924C5	0.0	2147	1680	0.644	0.731	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
2	Q86TB3	2.75e-96	349	2170	0.094	0.083	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
3	F1QU13	4.72e-66	251	1966	0.068	0.066	ALPK2_DANRE Alpha-protein kinase 2 OS=Danio rerio OX=7955 GN=alpk2 PE=2 SV=2
4	F1N9Z6	1.50e-10	69.3	1587	0.018	0.022	F1N9Z6_CHICK Myomesin 1 OS=Gallus gallus OX=9031 GN=MYOM1 PE=4 SV=4
5	A0A8I6GBP8	1.75e-10	68.9	1689	0.018	0.021	A0A8I6GBP8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
6	A0A0G2K5P5	1.92e-10	68.9	1676	0.018	0.021	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
7	P52179	2.60e-10	68.6	1685	0.020	0.023	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
8	A0A8I6GFM8	2.84e-10	68.2	1592	0.018	0.022	A0A8I6GFM8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
9	Q6PDN3	3.86e-10	67.8	1941	0.020	0.020	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
10	Q15746	4.96e-10	67.4	1914	0.021	0.021	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
11	Q5VTT5	5.73e-10	67.4	1437	0.019	0.026	MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 PE=1 SV=1
12	Q62234	8.15e-10	67.0	1667	0.018	0.020	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
13	Q15772	1.24e-09	66.2	3267	0.019	0.011	SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens OX=9606 GN=SPEG PE=1 SV=4
14	A2ABU4	2.70e-09	65.1	1439	0.018	0.024	MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 PE=1 SV=1
15	Q63638	7.24e-09	63.9	3259	0.019	0.011	SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Speg PE=1 SV=2
16	A0A0B4KG35	1.01e-08	63.5	8255	0.019	0.004	A0A0B4KG35_DROME Stretchin-Mlck, isoform U OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
17	A0A0B4KF84	1.09e-08	63.2	8216	0.019	0.004	A0A0B4KF84_DROME Stretchin-Mlck, isoform S OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
18	Q62407	1.15e-08	63.2	3262	0.018	0.011	SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Speg PE=1 SV=2
19	A0A0B4JD82	1.18e-08	63.2	7905	0.019	0.005	A0A0B4JD82_DROME Stretchin-Mlck, isoform T OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
20	A1ZA72	1.18e-08	63.2	7944	0.019	0.005	A1ZA72_DROME Stretchin-Mlck, isoform V OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	69	14.6	Adenovirus E3 region protein CR1
2	PF02816 Alpha_kinase	2.1e-24	98.2	Alpha-kinase family
3	PF08205 C2-set_2	16	16.9	CD80-like C2-set immunoglobulin domain
4	PF07679 I-set	3e-19	80.2	Immunoglobulin I-set domain
5	PF00047 ig	0.0015	30.0	Immunoglobulin domain
6	PF13895 Ig_2	1.1e-07	43.4	Immunoglobulin domain
7	PF13927 Ig_3	2.6e-12	58.4	Immunoglobulin domain
8	PF07686 V-set	2.3	19.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258888

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307235	0.725	Eukaryotic translation initiation factor 2-alpha kinase 3
2	9606.ENSP00000339906	0.720	Paired box protein Pax-4
3	9606.ENSP00000299432	0.683	Putative protein MSS51 homolog, mitochondrial
4	9606.ENSP00000357475	0.683	Phospholipid-transporting ATPase ID
5	9606.ENSP00000040738	0.681	Biorientation of chromosomes in cell division protein 1-like 1
6	9606.ENSP00000312143	0.676	Tensin-3
7	9606.ENSP00000385636	0.613	Obscurin-like protein 1
8	9606.ENSP00000414909	0.587	Uncharacterized protein C1orf167
9	9606.ENSP00000219301	0.568	Serine protease 54
10	9606.ENSP00000452877	0.559	Zinc finger protein 592
11	9606.ENSP00000362784	0.558	Olfactory receptor 5C1
12	9606.ENSP00000398048	0.556	Alpha-protein kinase 1
13	9606.ENSP00000298110	0.550	Probable G-protein coupled receptor 101
14	9606.ENSP00000282020	0.535	Glutamate receptor ionotropic, delta-2
15	9606.ENSP00000205557	0.534	Multidrug resistance-associated protein 6
16	9606.ENSP00000279146	0.524	AH receptor-interacting protein
17	9606.ENSP00000387292	0.508	Transmembrane protein 150A
18	9606.ENSP00000409016	0.508	Transforming growth factor beta regulator 1
19	9606.ENSP00000343140	0.505	Xin actin-binding repeat-containing protein 1
20	9606.ENSP00000471730	0.505	Protein PPP5D1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.448	catalytic activity
GO:0140096	0.392	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0032502	0.942	developmental process
GO:0032501	0.938	multicellular organismal process
GO:0048856	0.869	anatomical structure development
GO:0065007	0.785	biological regulation
GO:0007275	0.723	multicellular organism development
GO:0050789	0.711	regulation of biological process
GO:0048731	0.696	system development
GO:0048513	0.591	animal organ development
GO:0050794	0.557	regulation of cellular process
GO:0071704	0.451	organic substance metabolic process
GO:0061061	0.451	muscle structure development
GO:0044238	0.423	primary metabolic process
GO:0072359	0.410	circulatory system development
GO:0006807	0.368	nitrogen compound metabolic process
GO:0009888	0.354	tissue development
GO:0030154	0.345	cell differentiation
GO:0042692	0.316	muscle cell differentiation
GO:0048468	0.302	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.949	cytoplasm
GO:0016020	0.824	membrane
GO:0043232	0.773	intracellular non-membrane-bounded organelle
GO:0071944	0.750	cell periphery
GO:0031981	0.472	nuclear lumen
GO:0005886	0.437	plasma membrane
GO:0005829	0.396	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]