StarFunc result for job id Q96LA5

User Input

>input (508 residues)
MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSV
FKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIE
GGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAE
TVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWY
REATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRP
VLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTA
EHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYA
LFHKISGESSATNEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSQVWSM
QQPESSANIRTLLENKDSQVIYSSVKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LA5	1.000	1.000	5.951E-83	508	1.000	1.000	Q96LA5.pdb.gz	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
2	AFDB:Q96P31	0.652	0.459	4.368E-48	734	0.533	0.369	Q96P31.pdb.gz	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
3	AFDB:Q96RD9	0.336	0.178	1.216E-39	977	0.382	0.199	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
4	AFDB:Q6DN72	0.335	0.389	1.641E-28	434	0.266	0.311	Q6DN72.pdb.gz	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
5	AFDB:Q3SWT0	0.368	0.286	5.197E-26	678	0.185	0.139	Q3SWT0.pdb.gz	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
6	AFDB:Q08481	0.375	0.275	9.598E-26	727	0.207	0.144	Q08481.pdb.gz	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
7	AFDB:P31809	0.293	0.288	1.877E-24	521	0.228	0.223	P31809.pdb.gz	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
8	AFDB:Q925P2	0.280	0.276	1.877E-24	520	0.217	0.212	Q925P2.pdb.gz	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
9	AFDB:P16573	0.307	0.302	9.001E-23	519	0.209	0.204	P16573.pdb.gz	CEAM1_RAT Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ceacam1 PE=1 SV=4
10	AFDB:Q9D2Z1	0.296	0.265	4.922E-22	577	0.183	0.161	Q9D2Z1.pdb.gz	CEA20_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 20 OS=Mus musculus OX=10090 GN=Ceacam20 PE=1 SV=1
11	PDB:5oj2B	0.257	0.198	7.045E-13	692	0.142	0.104	5oj2B.pdb.gz
12	PDB:1e07A	0.323	0.273	1.088E-11	642	0.114	0.090	1e07A.pdb.gz
13	PDB:7q1yA	0.161	0.077	8.365E-10	1374	0.114	0.042	7q1yA.pdb.gz
14	PDB:7q5zA	0.164	0.078	1.110E-9	1344	0.104	0.039	7q5zA.pdb.gz
15	PDB:4lnvB	0.148	0.085	2.363E-9	1063	0.132	0.063	4lnvB.pdb.gz
16	PDB:6dldD	0.230	0.383	3.788E-9	269	0.122	0.230	6dldD.pdb.gz
17	PDB:4rtdA	0.179	0.094	1.021E-8	1122	0.102	0.046	4rtdA.pdb.gz
18	PDB:6dlfA	0.200	0.364	1.233E-8	236	0.116	0.250	6dlfA.pdb.gz
19	PDB:4lnvA	0.155	0.079	2.502E-8	1276	0.096	0.038	4lnvA.pdb.gz
20	PDB:5a42A	0.170	0.066	8.142E-8	1597	0.100	0.032	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LA5	0.0	1046	508	1.000	1.000	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
2	Q96P31	2.01e-158	469	734	0.447	0.309	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
3	Q96LA6	3.15e-153	446	429	0.467	0.552	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
4	Q68SN8	1.54e-122	373	596	0.419	0.357	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
5	Q96RD9	5.35e-91	300	977	0.339	0.176	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
6	Q96PJ5	3.95e-88	281	515	0.283	0.280	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
7	Q6DN72	2.97e-34	135	434	0.179	0.210	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
8	Q7L513	1.50e-27	115	359	0.138	0.195	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
9	Q5DRQ8	3.60e-25	109	427	0.167	0.199	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
10	Q920A9	5.22e-25	108	352	0.142	0.205	FCRLA_MOUSE Fc receptor-like A OS=Mus musculus OX=10090 GN=Fcrla PE=1 SV=1
11	A1YIY0	8.66e-23	100	268	0.152	0.287	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
12	Q6BAA4	1.20e-21	99.4	426	0.124	0.148	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
13	P12314	1.23e-20	95.9	374	0.124	0.168	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
14	A0A0B4J2J0	1.10e-18	89.7	353	0.118	0.170	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
15	P26151	1.24e-18	90.1	404	0.130	0.163	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
16	Q24372	2.64e-12	70.5	359	0.118	0.167	LACH_DROME Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2
17	Q08481	8.40e-12	70.1	727	0.171	0.120	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
18	P31809	9.64e-12	69.7	521	0.205	0.200	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
19	Q8WZ42	2.19e-11	69.3	34350	0.203	0.003	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
20	P16284	5.42e-11	67.4	738	0.232	0.160	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	48	15.4	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	1.3e-14	65.3	Immunoglobulin I-set domain
3	PF00047 ig	2.2e-20	83.9	Immunoglobulin domain
4	PF13895 Ig_2	1.5e-37	139.1	Immunoglobulin domain
5	PF13927 Ig_3	1.4e-33	126.6	Immunoglobulin domain
6	PF16680 Ig_4	0.03	26.2	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	0.19	23.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF18452 Ig_6	33	15.8	Immunoglobulin domain
9	PF19081 Ig_7	58	15.4	Ig-like domain CHU_C associated
10	PF17736 Ig_C17orf99	1.2e-08	46.2	C17orf99 Ig domain
11	PF16706 Izumo-Ig	1.7	20.0	Izumo-like Immunoglobulin domain
12	PF20258 tRNA_Me_trans_C	77	15.0	Aminomethyltransferase beta-barrel domain
13	PF07686 V-set	2.8e-08	45.3	Immunoglobulin V-set domain
14	PF08204 V-set_CD47	8.7e+02	11.3	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348888	0.772	Polymeric immunoglobulin receptor
2	9606.ENSP00000357149	0.635	T-cell surface glycoprotein CD1e, membrane-associated
3	9606.ENSP00000300850	0.625	Zinc finger protein 646
4	9606.ENSP00000271450	0.618	Low affinity immunoglobulin gamma Fc region receptor II-a
5	9606.ENSP00000343636	0.612	GDNF family receptor alpha like
6	9606.ENSP00000352138	0.606	Kin of IRRE-like protein 1
7	9606.ENSP00000351497	0.562	Low affinity immunoglobulin gamma Fc region receptor II-b
8	9606.ENSP00000376553	0.552	Transmembrane protein 119
9	9606.ENSP00000369756	0.543	Receptor-type tyrosine-protein phosphatase alpha
10	9606.ENSP00000322273	0.512	Olfactomedin-like protein 3
11	9606.ENSP00000307259	0.506	P2Y purinoceptor 12
12	9606.ENSP00000484824	0.505	Mucin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019903	0.997	protein phosphatase binding
GO:0030674	0.856	protein-macromolecule adaptor activity
GO:0035591	0.852	signaling adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.925	response to stimulus
GO:0002376	0.868	immune system process
GO:0048518	0.843	positive regulation of biological process
GO:0032501	0.799	multicellular organismal process
GO:0023052	0.795	signaling
GO:0051716	0.785	cellular response to stimulus
GO:0050776	0.778	regulation of immune response
GO:0007165	0.766	signal transduction
GO:0019222	0.745	regulation of metabolic process
GO:0002683	0.649	negative regulation of immune system process
GO:0010646	0.627	regulation of cell communication
GO:0023051	0.621	regulation of signaling
GO:0060255	0.607	regulation of macromolecule metabolic process
GO:0048522	0.590	positive regulation of cellular process
GO:0002684	0.527	positive regulation of immune system process
GO:0031323	0.504	regulation of cellular metabolic process
GO:0048584	0.483	positive regulation of response to stimulus
GO:0080090	0.478	regulation of primary metabolic process
GO:0009966	0.424	regulation of signal transduction
GO:0032879	0.369	regulation of localization
GO:0007166	0.368	cell surface receptor signaling pathway
GO:0009893	0.337	positive regulation of metabolic process
GO:0019220	0.335	regulation of phosphate metabolic process
GO:0051239	0.330	regulation of multicellular organismal process
GO:0001775	0.329	cell activation
GO:0031325	0.324	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.998	cell surface
GO:0071944	0.848	cell periphery
GO:0005886	0.813	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]