StarFunc result for job id Q96LB4

User Input

>input (118 residues)
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQS
KIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LB4	1.000	1.000	2.009E-15	118	1.000	1.000	Q96LB4.pdb.gz	VATG3_HUMAN V-type proton ATPase subunit G 3 OS=Homo sapiens OX=9606 GN=ATP6V1G3 PE=1 SV=1
2	AFDB:D3ZTZ4	0.991	0.991	9.868E-13	118	0.814	0.814	D3ZTZ4.pdb.gz	D3ZTZ4_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g3 PE=1 SV=2
3	AFDB:O95670	0.907	0.907	1.216E-8	118	0.542	0.542	O95670.pdb.gz	VATG2_HUMAN V-type proton ATPase subunit G 2 OS=Homo sapiens OX=9606 GN=ATP6V1G2 PE=1 SV=1
4	AFDB:B2GUV5	0.850	0.850	2.354E-8	118	0.534	0.534	B2GUV5.pdb.gz	B2GUV5_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g1 PE=2 SV=1
5	PDB:6vq6M	0.669	0.688	4.655E-8	114	0.525	0.544	6vq6M.pdb.gz	Structure of V-ATPase from the mammalian brain.
6	PDB:6wm2K	0.618	0.634	2.430E-7	114	0.517	0.535	6wm2K.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
7	AFDB:Q9XZH6	0.747	0.752	3.083E-6	117	0.381	0.385	Q9XZH6.pdb.gz	VATG_DROME V-type proton ATPase subunit G OS=Drosophila melanogaster OX=7227 GN=Vha13 PE=1 SV=1
8	AFDB:P91303	0.734	0.695	3.637E-6	126	0.407	0.381	P91303.pdb.gz	VATG_CAEEL Probable V-type proton ATPase subunit G OS=Caenorhabditis elegans OX=6239 GN=vha-10 PE=1 SV=1
9	AFDB:O74174	0.787	0.852	2.932E-3	108	0.297	0.324	O74174.pdb.gz	VATG_SCHPO V-type proton ATPase subunit G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma10 PE=3 SV=2
10	AFDB:P48836	0.903	0.934	4.814E-3	114	0.339	0.351	P48836.pdb.gz	VATG_YEAST V-type proton ATPase subunit G OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA10 PE=1 SV=1
11	AFDB:Q54Z13	0.816	0.895	3.497E-2	107	0.254	0.280	Q54Z13.pdb.gz	VATG_DICDI V-type proton ATPase subunit G OS=Dictyostelium discoideum OX=44689 GN=atp6v1g PE=1 SV=2
12	AFDB:Q9SZH0	0.656	0.703	1.424E-1	108	0.263	0.287	Q9SZH0.pdb.gz	VATG3_ARATH V-type proton ATPase subunit G3 OS=Arabidopsis thaliana OX=3702 GN=VHA-G3 PE=3 SV=1
13	PDB:7r0cA	0.119	0.054	2.847	284	0.059	0.025	7r0cA.pdb.gz	Structure of the vasopressin hormone-V2 receptor-beta-arrestin1 ternary complex.
14	PDB:5bw9n	0.305	0.604	5.076	58	0.102	0.207	5bw9n.pdb.gz
15	PDB:3j96A	0.123	0.025	6.504	678	0.093	0.016	3j96A.pdb.gz
16	PDB:7y4sA	0.363	0.169	7.065	343	0.169	0.058	7y4sA.pdb.gz
17	PDB:7wi3B	0.387	0.187	9.052	275	0.136	0.058	7wi3B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LB4	2.13e-83	241	118	1.000	1.000	VATG3_HUMAN V-type proton ATPase subunit G 3 OS=Homo sapiens OX=9606 GN=ATP6V1G3 PE=1 SV=1
2	Q8BMC1	2.23e-68	202	118	0.839	0.839	VATG3_MOUSE V-type proton ATPase subunit G 3 OS=Mus musculus OX=10090 GN=Atp6v1g3 PE=1 SV=1
3	D3ZTZ4	3.05e-66	199	155	0.814	0.619	D3ZTZ4_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g3 PE=1 SV=2
4	Q0VCV6	1.38e-42	137	118	0.551	0.551	VATG2_BOVIN V-type proton ATPase subunit G 2 OS=Bos taurus OX=9913 GN=ATP6V1G2 PE=1 SV=1
5	Q8R2H0	1.39e-42	137	118	0.551	0.551	Q8R2H0_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g2 PE=1 SV=1
6	Q9WTT4	1.95e-41	134	118	0.534	0.534	VATG2_MOUSE V-type proton ATPase subunit G 2 OS=Mus musculus OX=10090 GN=Atp6v1g2 PE=1 SV=1
7	O95670	2.48e-41	134	118	0.542	0.542	VATG2_HUMAN V-type proton ATPase subunit G 2 OS=Homo sapiens OX=9606 GN=ATP6V1G2 PE=1 SV=1
8	Q9CR51	6.21e-41	133	118	0.534	0.534	VATG1_MOUSE V-type proton ATPase subunit G 1 OS=Mus musculus OX=10090 GN=Atp6v1g1 PE=1 SV=3
9	O75348	8.81e-41	133	118	0.534	0.534	VATG1_HUMAN V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3
10	B2GUV5	1.35e-40	132	118	0.534	0.534	B2GUV5_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g1 PE=2 SV=1
11	A0A8I6B3N3	6.72e-38	125	116	0.525	0.534	A0A8I6B3N3_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g1 PE=1 SV=1
12	A0A0G2KAG3	1.65e-27	99.0	93	0.381	0.484	A0A0G2KAG3_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g2 PE=3 SV=2
13	P91303	7.39e-26	95.5	126	0.407	0.381	VATG_CAEEL Probable V-type proton ATPase subunit G OS=Caenorhabditis elegans OX=6239 GN=vha-10 PE=1 SV=1
14	Q9XZH6	7.92e-24	90.1	117	0.381	0.385	VATG_DROME V-type proton ATPase subunit G OS=Drosophila melanogaster OX=7227 GN=Vha13 PE=1 SV=1
15	A0A0G2K2R1	4.28e-20	80.1	91	0.331	0.429	A0A0G2K2R1_RAT V-type proton ATPase subunit G OS=Rattus norvegicus OX=10116 GN=Atp6v1g2 PE=3 SV=1
16	P48836	5.23e-12	59.7	114	0.339	0.351	VATG_YEAST V-type proton ATPase subunit G OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA10 PE=1 SV=1
17	O82629	9.20e-09	51.2	106	0.280	0.311	VATG2_ARATH V-type proton ATPase subunit G2 OS=Arabidopsis thaliana OX=3702 GN=VHA-G2 PE=1 SV=2
18	O74174	1.03e-07	48.5	108	0.297	0.324	VATG_SCHPO V-type proton ATPase subunit G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma10 PE=3 SV=2
19	Q54Z13	4.97e-07	46.6	107	0.246	0.271	VATG_DICDI V-type proton ATPase subunit G OS=Dictyostelium discoideum OX=44689 GN=atp6v1g PE=1 SV=2
20	Q9SZH0	7.99e-04	38.5	108	0.246	0.269	VATG3_ARATH V-type proton ATPase subunit G3 OS=Arabidopsis thaliana OX=3702 GN=VHA-G3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04216 FdhE	49	15.3	Protein involved in formate dehydrogenase formation
2	PF03938 OmpH	2.1e+02	13.6	Outer membrane protein (OmpH-like)
3	PF12072 RNase_Y_N	35	15.3	RNase Y N-terminal region
4	PF03179 V-ATPase_G	1.1e-33	127.3	Vacuolar (H+)-ATPase G subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417378	0.989	ATPase H+ transporting V1 subunit F
2	9606.ENSP00000304891	0.986	V-type proton ATPase subunit E 2
3	9606.ENSP00000216442	0.983	V-type proton ATPase subunit D
4	9606.ENSP00000273398	0.977	V-type proton ATPase catalytic subunit A
5	9606.ENSP00000352522	0.977	V-type proton ATPase subunit H
6	9606.ENSP00000434729	0.977	V-type proton ATPase 21 kDa proteolipid subunit
7	9606.ENSP00000272238	0.971	V-type proton ATPase subunit C 2
8	9606.ENSP00000290949	0.971	V-type proton ATPase subunit d 1
9	9606.ENSP00000234396	0.967	V-type proton ATPase subunit B, kidney isoform
10	9606.ENSP00000253413	0.967	V-type proton ATPase subunit E 1
11	9606.ENSP00000329757	0.965	V-type proton ATPase 16 kDa proteolipid subunit
12	9606.ENSP00000285393	0.964	V-type proton ATPase subunit d 2
13	9606.ENSP00000379203	0.962	V-type proton ATPase subunit C 1
14	9606.ENSP00000276390	0.960	V-type proton ATPase subunit B, brain isoform
15	9606.ENSP00000308122	0.960	V-type proton ATPase 116 kDa subunit a isoform 4
16	9606.ENSP00000264649	0.958	V-type proton ATPase 116 kDa subunit a isoform 1
17	9606.ENSP00000332247	0.956	V-type proton ATPase 116 kDa subunit a isoform 2
18	9606.ENSP00000265686	0.926	V-type proton ATPase 116 kDa subunit a isoform 3
19	9606.ENSP00000264433	0.906	Folliculin-interacting protein 2
20	9606.ENSP00000421985	0.906	Folliculin-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051117	1.000	ATPase binding
GO:0005215	0.987	transporter activity
GO:0022857	0.984	transmembrane transporter activity
GO:0022890	0.971	inorganic cation transmembrane transporter activity
GO:0008324	0.971	monoatomic cation transmembrane transporter activity
GO:0140657	0.966	ATP-dependent activity
GO:0015078	0.954	proton transmembrane transporter activity
GO:0042626	0.941	ATPase-coupled transmembrane transporter activity
GO:0009678	0.904	pyrophosphate hydrolysis-driven proton transmembrane transporter activity
GO:0019829	0.898	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0042625	0.844	ATPase-coupled ion transmembrane transporter activity
GO:0046961	0.781	proton-transporting ATPase activity, rotational mechanism
GO:0003824	0.361	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.984	localization
GO:0055085	0.972	transmembrane transport
GO:1902600	0.926	proton transmembrane transport
GO:0065007	0.398	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005829	0.996	cytosol
GO:0043226	0.875	organelle
GO:0043229	0.839	intracellular organelle
GO:0032991	0.809	protein-containing complex
GO:0043227	0.745	membrane-bounded organelle
GO:0043231	0.713	intracellular membrane-bounded organelle
GO:0031090	0.343	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.942	Translocases.
RHEA:13973	0.904	diphosphate + H(+)(in) + H2O = 2 H(+)(out) + 2 phosphate
EC:7.1.3.1	0.904	H(+)-exporting diphosphatase.
RHEA:57721	0.781	ATP + 4 H(+)(in) + H2O => ADP + 5 H(+)(out) + phosphate

[back to server]