StarFunc result for job id Q96LB8

User Input

>input (373 residues)
MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA
WGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFL
VGDDGRVYEGVGWNIQGVHTQGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKG
HLSSSYVQPLLGKGENCLAPRQKTSLKKACPGVVPRSVWGARETHCPRMTLPAKYGIIIH
TAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGY
DDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQA
LYNIISTWPHFKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LB8	1.000	1.000	4.286E-84	373	1.000	1.000	Q96LB8.pdb.gz	PGRP4_HUMAN Peptidoglycan recognition protein 4 OS=Homo sapiens OX=9606 GN=PGLYRP4 PE=1 SV=2
2	AFDB:Q0VB07	0.704	0.702	2.645E-66	374	0.756	0.754	Q0VB07.pdb.gz	PGRP4_MOUSE Peptidoglycan recognition protein 4 OS=Mus musculus OX=10090 GN=Pglyrp4 PE=2 SV=1
3	AFDB:Q96LB9	0.448	0.489	1.246E-53	341	0.617	0.674	Q96LB9.pdb.gz	PGRP3_HUMAN Peptidoglycan recognition protein 3 OS=Homo sapiens OX=9606 GN=PGLYRP3 PE=1 SV=1
4	AFDB:A1A547	0.449	0.482	5.394E-53	347	0.558	0.599	A1A547.pdb.gz	PGRP3_MOUSE Peptidoglycan recognition protein 3 OS=Mus musculus OX=10090 GN=Pglyrp3 PE=2 SV=2
5	AFDB:Q8SXQ7	0.408	0.411	2.560E-29	369	0.271	0.274	Q8SXQ7.pdb.gz	PGPLF_DROME Peptidoglycan-recognition protein LF OS=Drosophila melanogaster OX=7227 GN=PGRP-LF PE=1 SV=1
6	AFDB:O75594	0.439	0.829	9.056E-23	196	0.201	0.383	O75594.pdb.gz	PGRP1_HUMAN Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1
7	AFDB:Q9GK12	0.430	0.821	2.405E-22	193	0.196	0.378	Q9GK12.pdb.gz	PGRP1_CAMDR Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1
8	AFDB:Q9JLN4	0.443	0.888	3.264E-22	183	0.193	0.393	Q9JLN4.pdb.gz	PGRP1_RAT Peptidoglycan recognition protein 1 OS=Rattus norvegicus OX=10116 GN=Pglyrp1 PE=1 SV=1
9	AFDB:O88593	0.444	0.893	3.469E-22	182	0.201	0.412	O88593.pdb.gz	PGRP1_MOUSE Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
10	AFDB:Q9VXN9	0.444	0.479	7.217E-22	345	0.225	0.243	Q9VXN9.pdb.gz	PGPLE_DROME Peptidoglycan-recognition protein LE OS=Drosophila melanogaster OX=7227 GN=PGRP-LE PE=1 SV=1
11	PDB:1yckA	0.435	0.964	8.752E-22	167	0.188	0.419	1yckA.pdb.gz
12	PDB:3cg9A	0.436	0.940	8.752E-22	171	0.196	0.427	3cg9A.pdb.gz	Crystal structure of the complex of peptidoglycan recognition protein with methyoxane-2,3,4,5-tetrol at 2.9 A resolution
13	PDB:1sxrA	0.434	0.927	2.719E-19	173	0.169	0.364	1sxrA.pdb.gz
14	PDB:2rkqA	0.427	0.930	6.012E-19	169	0.158	0.349	2rkqA.pdb.gz
15	PDB:1ohtA	0.429	0.917	5.754E-18	173	0.174	0.376	1ohtA.pdb.gz	Crystal Structure of Peptidoglycan Recognition Protein Lb from Drosophila Melanogaster
16	PDB:1aroL	0.293	0.692	8.214E-8	149	0.070	0.174	1aroL.pdb.gz
17	PDB:6fhgA	0.329	0.746	9.280E-8	156	0.088	0.212	6fhgA.pdb.gz	Structure and function of the Ts2631 endolysin of Thermus scotoductus phage vB_Tsc2631 with unique N-terminal extension used for peptidoglycan binding.
18	PDB:4bxdA	0.250	0.352	5.494E-3	255	0.070	0.102	4bxdA.pdb.gz	Cell-Wall Remodeling by the Zinc-Protease Ampdh3 from Pseudomonas Aeruginosa.
19	PDB:1j3gA	0.273	0.480	5.840E-3	187	0.072	0.144	1j3gA.pdb.gz	NMR Structure of Citrobacter freundii AmpD, Comparison with Bacteriophage T7 Lysozyme and Homology with PGRP Domains
20	PDB:7epuB	0.121	0.070	1.421	748	0.051	0.025	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VB07	0.0	595	374	0.759	0.757	PGRP4_MOUSE Peptidoglycan recognition protein 4 OS=Mus musculus OX=10090 GN=Pglyrp4 PE=2 SV=1
2	Q96LB8	0.0	776	373	1.000	1.000	PGRP4_HUMAN Peptidoglycan recognition protein 4 OS=Homo sapiens OX=9606 GN=PGLYRP4 PE=1 SV=2
3	Q96LB9	3.32e-161	457	341	0.617	0.674	PGRP3_HUMAN Peptidoglycan recognition protein 3 OS=Homo sapiens OX=9606 GN=PGLYRP3 PE=1 SV=1
4	A1A547	5.49e-157	446	347	0.555	0.597	PGRP3_MOUSE Peptidoglycan recognition protein 3 OS=Mus musculus OX=10090 GN=Pglyrp3 PE=2 SV=2
5	O75594	9.49e-48	162	196	0.198	0.378	PGRP1_HUMAN Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1
6	O88593	1.26e-47	161	182	0.196	0.401	PGRP1_MOUSE Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
7	Q9GK12	5.29e-46	157	193	0.196	0.378	PGRP1_CAMDR Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1
8	Q9JLN4	7.75e-45	154	183	0.193	0.393	PGRP1_RAT Peptidoglycan recognition protein 1 OS=Rattus norvegicus OX=10116 GN=Pglyrp1 PE=1 SV=1
9	Q70PY2	1.17e-40	144	190	0.188	0.368	PGSB1_DROME Peptidoglycan-recognition protein SB1 OS=Drosophila melanogaster OX=7227 GN=PGRP-SB1 PE=2 SV=2
10	Q8SXQ7	5.86e-36	136	369	0.255	0.257	PGPLF_DROME Peptidoglycan-recognition protein LF OS=Drosophila melanogaster OX=7227 GN=PGRP-LF PE=1 SV=1
11	Q9VXN9	7.26e-36	135	345	0.193	0.209	PGPLE_DROME Peptidoglycan-recognition protein LE OS=Drosophila melanogaster OX=7227 GN=PGRP-LE PE=1 SV=1
12	Q9VYX7	3.59e-35	130	203	0.180	0.330	PGPSA_DROME Peptidoglycan-recognition protein SA OS=Drosophila melanogaster OX=7227 GN=PGRP-SA PE=1 SV=1
13	Q9VV96	1.65e-33	124	182	0.177	0.363	PGSB2_DROME Peptidoglycan-recognition protein SB2 OS=Drosophila melanogaster OX=7227 GN=PGRP-SB2 PE=2 SV=1
14	Q8VCS0	2.75e-33	132	530	0.190	0.134	PGRP2_MOUSE N-acetylmuramoyl-L-alanine amidase OS=Mus musculus OX=10090 GN=Pglyrp2 PE=1 SV=1
15	Q9V4X2	7.72e-33	123	184	0.155	0.315	PGSC2_DROME Peptidoglycan-recognition protein SC2 OS=Drosophila melanogaster OX=7227 GN=PGRP-SC2 PE=2 SV=1
16	A0A060VTM4	3.70e-30	122	491	0.177	0.134	A0A060VTM4_ONCMY Peptidoglycan recognition protein 6 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077461001 PE=3 SV=1
17	Q9VS97	8.61e-30	115	186	0.155	0.312	PGPSD_DROME Peptidoglycan-recognition protein SD OS=Drosophila melanogaster OX=7227 GN=PGRP-SD PE=1 SV=1
18	A0A060Y1K9	9.33e-30	121	478	0.174	0.136	A0A060Y1K9_ONCMY Peptidoglycan recognition protein 6 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00002311001 PE=3 SV=1
19	C0HK98	1.17e-29	114	185	0.153	0.308	SC1A_DROME Peptidoglycan-recognition protein SC1a OS=Drosophila melanogaster OX=7227 GN=PGRP-SC1a PE=3 SV=1
20	C0HK99	1.17e-29	114	185	0.153	0.308	SC1B_DROME Peptidoglycan-recognition protein SC1b OS=Drosophila melanogaster OX=7227 GN=PGRP-SC1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01510 Amidase_2	7.4e-27	105.7	N-acetylmuramoyl-L-alanine amidase
2	PF16060 DUF4802	1.4e+02	13.9	Domain of unknown function (DUF4802)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290722	0.874	Peptidoglycan recognition protein 3
2	9606.ENSP00000335358	0.734	Late cornified envelope protein 3B
3	9606.ENSP00000334869	0.732	Late cornified envelope protein 1A
4	9606.ENSP00000334644	0.720	Late cornified envelope protein 3C
5	9606.ENSP00000311837	0.617	Gamma-2-syntrophin
6	9606.ENSP00000272643	0.605	Thrombospondin type-1 domain-containing protein 7B
7	9606.ENSP00000351591	0.565	Neuroligin-3
8	9606.ENSP00000357753	0.562	Involucrin
9	9606.ENSP00000334456	0.518	Olfactory receptor 5D14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038187	0.999	pattern recognition receptor activity
GO:0046982	0.999	protein heterodimerization activity
GO:0042834	0.999	peptidoglycan binding
GO:0016019	0.961	peptidoglycan immune receptor activity
GO:0016787	0.367	hydrolase activity
GO:0008745	0.327	N-acetylmuramoyl-L-alanine amidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0044419	0.977	biological process involved in interspecies interaction between organisms
GO:0009987	0.946	cellular process
GO:0042742	0.939	defense response to bacterium
GO:0098581	0.925	detection of external biotic stimulus
GO:0050830	0.922	defense response to Gram-positive bacterium
GO:0031640	0.911	killing of cells of another organism
GO:0019730	0.870	antimicrobial humoral response
GO:0061844	0.725	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050789	0.327	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0110165	0.967	cellular anatomical entity
GO:0005576	0.880	extracellular region
GO:0071944	0.447	cell periphery
GO:0005886	0.380	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.367	Hydrolases.
EC:3.5.1.28	0.327	N-acetylmuramoyl-L-alanine amidase.

[back to server]