StarFunc result for job id Q96LB9

User Input

>input (341 residues)
MGTLPWLLAFFILGLQAWDTPTIVSRKEWGARPLACRALLTLPVAYIITDQLPGMQCQQQ
SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQGYNNISLGIAF
FGNKIGSSPSPAALSAAEGLISYAIQKGHLSPRYIQPLLLKEETCLDPQHPVMPRKVCPN
IIKRSAWEARETHCPKMNLPAKYVIIIHTAGTSCTVSTDCQTVVRNIQSFHMDTRNFCDI
GYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQC
AVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHFKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LB9	1.000	1.000	4.647E-78	341	1.000	1.000	Q96LB9.pdb.gz	PGRP3_HUMAN Peptidoglycan recognition protein 3 OS=Homo sapiens OX=9606 GN=PGLYRP3 PE=1 SV=1
2	AFDB:A1A547	0.902	0.887	1.636E-60	347	0.733	0.720	A1A547.pdb.gz	PGRP3_MOUSE Peptidoglycan recognition protein 3 OS=Mus musculus OX=10090 GN=Pglyrp3 PE=2 SV=2
3	AFDB:Q96LB8	0.489	0.448	3.801E-54	373	0.674	0.617	Q96LB8.pdb.gz	PGRP4_HUMAN Peptidoglycan recognition protein 4 OS=Homo sapiens OX=9606 GN=PGLYRP4 PE=1 SV=2
4	AFDB:Q0VB07	0.487	0.444	1.064E-53	374	0.639	0.583	Q0VB07.pdb.gz	PGRP4_MOUSE Peptidoglycan recognition protein 4 OS=Mus musculus OX=10090 GN=Pglyrp4 PE=2 SV=1
5	AFDB:Q8SXQ7	0.395	0.366	2.587E-28	369	0.264	0.244	Q8SXQ7.pdb.gz	PGPLF_DROME Peptidoglycan-recognition protein LF OS=Drosophila melanogaster OX=7227 GN=PGRP-LF PE=1 SV=1
6	AFDB:O75594	0.476	0.824	2.424E-22	196	0.223	0.388	O75594.pdb.gz	PGRP1_HUMAN Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1
7	AFDB:Q9JLN4	0.472	0.868	1.244E-21	183	0.208	0.388	Q9JLN4.pdb.gz	PGRP1_RAT Peptidoglycan recognition protein 1 OS=Rattus norvegicus OX=10116 GN=Pglyrp1 PE=1 SV=1
8	PDB:1yckA	0.476	0.964	1.690E-21	167	0.214	0.437	1yckA.pdb.gz
9	AFDB:Q9GK12	0.472	0.827	5.654E-21	193	0.208	0.368	Q9GK12.pdb.gz	PGRP1_CAMDR Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1
10	AFDB:Q9VXN9	0.465	0.460	6.781E-21	345	0.223	0.220	Q9VXN9.pdb.gz	PGPLE_DROME Peptidoglycan-recognition protein LE OS=Drosophila melanogaster OX=7227 GN=PGRP-LE PE=1 SV=1
11	AFDB:O88593	0.480	0.890	9.180E-21	182	0.211	0.396	O88593.pdb.gz	PGRP1_MOUSE Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
12	PDB:3cg9A	0.477	0.942	1.248E-20	171	0.208	0.415	3cg9A.pdb.gz	Crystal structure of the complex of peptidoglycan recognition protein with methyoxane-2,3,4,5-tetrol at 2.9 A resolution
13	PDB:2rkqA	0.468	0.932	8.158E-20	169	0.196	0.396	2rkqA.pdb.gz
14	PDB:1sxrA	0.474	0.925	9.784E-20	173	0.211	0.416	1sxrA.pdb.gz
15	PDB:1ohtA	0.472	0.922	1.104E-18	173	0.188	0.370	1ohtA.pdb.gz	Crystal Structure of Peptidoglycan Recognition Protein Lb from Drosophila Melanogaster
16	PDB:6fhgA	0.361	0.754	5.626E-10	156	0.111	0.244	6fhgA.pdb.gz	Structure and function of the Ts2631 endolysin of Thermus scotoductus phage vB_Tsc2631 with unique N-terminal extension used for peptidoglycan binding.
17	PDB:1aroL	0.296	0.641	4.405E-7	149	0.079	0.181	1aroL.pdb.gz
18	PDB:4bj4A	0.269	0.362	4.960E-4	246	0.070	0.098	4bj4A.pdb.gz
19	PDB:3d2yA	0.259	0.335	9.658E-4	257	0.076	0.101	3d2yA.pdb.gz	Specific Structural Features of the N-Acetylmuramoyl-l-Alanine Amidase AmiD from Escherichia coli and Mechanistic Implications for Enzymes of This Family.
20	PDB:4bxdA	0.261	0.341	7.574E-3	255	0.073	0.098	4bxdA.pdb.gz	Cell-Wall Remodeling by the Zinc-Protease Ampdh3 from Pseudomonas Aeruginosa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A547	0.0	514	347	0.713	0.700	PGRP3_MOUSE Peptidoglycan recognition protein 3 OS=Mus musculus OX=10090 GN=Pglyrp3 PE=2 SV=2
2	Q96LB9	0.0	710	341	1.000	1.000	PGRP3_HUMAN Peptidoglycan recognition protein 3 OS=Homo sapiens OX=9606 GN=PGLYRP3 PE=1 SV=1
3	Q96LB8	1.06e-168	476	373	0.674	0.617	PGRP4_HUMAN Peptidoglycan recognition protein 4 OS=Homo sapiens OX=9606 GN=PGLYRP4 PE=1 SV=2
4	Q0VB07	7.65e-160	453	374	0.628	0.572	PGRP4_MOUSE Peptidoglycan recognition protein 4 OS=Mus musculus OX=10090 GN=Pglyrp4 PE=2 SV=1
5	O75594	2.05e-51	171	196	0.226	0.393	PGRP1_HUMAN Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1
6	O88593	2.26e-46	157	182	0.205	0.385	PGRP1_MOUSE Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
7	Q9GK12	1.04e-45	156	193	0.208	0.368	PGRP1_CAMDR Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1
8	Q9JLN4	1.78e-45	155	183	0.208	0.388	PGRP1_RAT Peptidoglycan recognition protein 1 OS=Rattus norvegicus OX=10116 GN=Pglyrp1 PE=1 SV=1
9	Q9VYX7	6.92e-45	154	203	0.217	0.365	PGPSA_DROME Peptidoglycan-recognition protein SA OS=Drosophila melanogaster OX=7227 GN=PGRP-SA PE=1 SV=1
10	Q70PY2	1.57e-41	145	190	0.211	0.379	PGSB1_DROME Peptidoglycan-recognition protein SB1 OS=Drosophila melanogaster OX=7227 GN=PGRP-SB1 PE=2 SV=2
11	Q8SXQ7	4.19e-39	144	369	0.267	0.247	PGPLF_DROME Peptidoglycan-recognition protein LF OS=Drosophila melanogaster OX=7227 GN=PGRP-LF PE=1 SV=1
12	Q9VXN9	6.26e-38	140	345	0.205	0.203	PGPLE_DROME Peptidoglycan-recognition protein LE OS=Drosophila melanogaster OX=7227 GN=PGRP-LE PE=1 SV=1
13	Q9VS97	1.16e-37	135	186	0.194	0.355	PGPSD_DROME Peptidoglycan-recognition protein SD OS=Drosophila melanogaster OX=7227 GN=PGRP-SD PE=1 SV=1
14	Q8VCS0	1.21e-36	140	530	0.205	0.132	PGRP2_MOUSE N-acetylmuramoyl-L-alanine amidase OS=Mus musculus OX=10090 GN=Pglyrp2 PE=1 SV=1
15	Q9V4X2	2.96e-35	129	184	0.185	0.342	PGSC2_DROME Peptidoglycan-recognition protein SC2 OS=Drosophila melanogaster OX=7227 GN=PGRP-SC2 PE=2 SV=1
16	Q96PD5	1.26e-34	135	576	0.208	0.123	PGRP2_HUMAN N-acetylmuramoyl-L-alanine amidase OS=Homo sapiens OX=9606 GN=PGLYRP2 PE=1 SV=1
17	A0A060VTM4	2.22e-34	133	491	0.208	0.145	A0A060VTM4_ONCMY Peptidoglycan recognition protein 6 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077461001 PE=3 SV=1
18	M9PNP3	9.19e-34	132	492	0.205	0.142	M9PNP3_ONCMY Peptidoglycan recognition protein L1 OS=Oncorhynchus mykiss OX=8022 GN=PGRP-L1 PE=2 SV=1
19	M9PNV5	9.57e-34	132	492	0.205	0.142	M9PNV5_ONCMY Peptidoglycan recognition protein L1 OS=Oncorhynchus mykiss OX=8022 GN=PGRP-L1 PE=3 SV=1
20	A0A060Y1K9	1.25e-33	131	478	0.205	0.146	A0A060Y1K9_ONCMY Peptidoglycan recognition protein 6 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00002311001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01510 Amidase_2	1.9e-28	110.9	N-acetylmuramoyl-L-alanine amidase
2	PF16505 Emaravirus_P4	5.1e+02	11.1	P4 movement protein of Emaravirus, and the 30K superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352672	0.874	Peptidoglycan recognition protein 4
2	9606.ENSP00000334869	0.752	Late cornified envelope protein 1A
3	9606.ENSP00000335358	0.734	Late cornified envelope protein 3B
4	9606.ENSP00000334644	0.731	Late cornified envelope protein 3C
5	9606.ENSP00000272643	0.697	Thrombospondin type-1 domain-containing protein 7B
6	9606.ENSP00000311837	0.689	Gamma-2-syntrophin
7	9606.ENSP00000357753	0.623	Involucrin
8	9606.ENSP00000314879	0.602	Hydroperoxide isomerase ALOXE3
9	9606.ENSP00000351591	0.575	Neuroligin-3
10	9606.ENSP00000315167	0.529	Arachidonate 12-lipoxygenase, 12R-type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038187	0.999	pattern recognition receptor activity
GO:0046982	0.999	protein heterodimerization activity
GO:0042834	0.999	peptidoglycan binding
GO:0016019	0.957	peptidoglycan immune receptor activity
GO:0003824	0.934	catalytic activity
GO:0016787	0.726	hydrolase activity
GO:0008745	0.315	N-acetylmuramoyl-L-alanine amidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044419	0.989	biological process involved in interspecies interaction between organisms
GO:0050896	0.986	response to stimulus
GO:0009987	0.976	cellular process
GO:0019730	0.970	antimicrobial humoral response
GO:0001906	0.949	cell killing
GO:0031640	0.941	killing of cells of another organism
GO:0051606	0.938	detection of stimulus
GO:0061844	0.911	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050830	0.898	defense response to Gram-positive bacterium
GO:0009595	0.862	detection of biotic stimulus
GO:0098581	0.840	detection of external biotic stimulus
GO:0065007	0.536	biological regulation
GO:0050789	0.507	regulation of biological process
GO:0050794	0.361	regulation of cellular process
GO:0008152	0.315	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0032991	0.997	protein-containing complex
GO:0005576	0.992	extracellular region
GO:0071944	0.448	cell periphery
GO:0005829	0.410	cytosol
GO:0005886	0.391	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.726	Hydrolases.
EC:3.5.1.28	0.315	N-acetylmuramoyl-L-alanine amidase.

[back to server]