StarFunc result for job id Q96LC7

User Input

>input (697 residues)
MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYW
FKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRV
ERGSYVRYNFMNDGFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSW
TGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVSAQRTVRLRVAYAPRD
LVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHP
WGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLE
NLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHE
GEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGE
ELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDK
KGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINV
VPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQE
SQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LC7	1.000	1.000	0.000	697	1.000	1.000	Q96LC7.pdb.gz	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
2	AFDB:Q96RL6	0.485	0.484	4.683E-86	698	0.694	0.693	Q96RL6.pdb.gz	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
3	AFDB:Q80ZE3	0.505	0.511	8.037E-76	688	0.594	0.602	Q80ZE3.pdb.gz	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
4	AFDB:A6NMB1	0.434	0.592	5.928E-60	481	0.495	0.717	A6NMB1.pdb.gz	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
5	AFDB:Q9NYZ4	0.292	0.401	7.643E-37	499	0.301	0.421	Q9NYZ4.pdb.gz	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
6	AFDB:Q96PQ1	0.349	0.396	1.417E-36	595	0.287	0.336	Q96PQ1.pdb.gz	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
7	AFDB:Q9Y286	0.298	0.435	4.136E-35	467	0.275	0.411	Q9Y286.pdb.gz	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
8	AFDB:Q9Y336	0.285	0.419	2.296E-32	463	0.277	0.417	Q9Y336.pdb.gz	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
9	AFDB:Q08ET2	0.282	0.474	1.689E-31	396	0.237	0.417	Q08ET2.pdb.gz	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
10	AFDB:B1Q236	0.244	0.234	1.085E-26	730	0.184	0.175	B1Q236.pdb.gz	SYG1_CAEEL Synaptogenesis protein syg-1 OS=Caenorhabditis elegans OX=6239 GN=syg-1 PE=1 SV=1
11	PDB:1e07A	0.214	0.227	4.662E-15	642	0.128	0.139	1e07A.pdb.gz
12	PDB:5oj2B	0.206	0.207	6.818E-15	692	0.129	0.130	5oj2B.pdb.gz
13	PDB:6dldD	0.206	0.427	5.145E-13	269	0.077	0.201	6dldD.pdb.gz
14	PDB:2rcjC	0.179	0.212	2.195E-11	523	0.132	0.176	2rcjC.pdb.gz
15	PDB:6h03A	0.131	0.085	8.708E-11	1223	0.092	0.052	6h03A.pdb.gz
16	PDB:7sqcO0	0.180	0.126	1.053E-10	1140	0.098	0.060	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6dlfA	0.210	0.492	1.104E-10	236	0.076	0.225	6dlfA.pdb.gz
18	PDB:4rtdA	0.120	0.085	2.723E-10	1122	0.085	0.053	4rtdA.pdb.gz
19	PDB:1hzhH	0.129	0.189	4.941E-9	457	0.105	0.160	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:4ziqA	0.111	0.063	8.333E-9	1450	0.082	0.039	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NMB1	0.0	680	481	0.488	0.707	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
2	Q80ZE3	0.0	771	688	0.585	0.593	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
3	Q96LC7	0.0	1429	697	1.000	1.000	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
4	Q96RL6	0.0	917	698	0.692	0.691	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
5	Q96PQ1	1.98e-81	272	595	0.220	0.257	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
6	Q9Y286	5.05e-81	267	467	0.207	0.308	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
7	Q9NYZ4	8.59e-81	267	499	0.232	0.325	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
8	Q08ET2	1.63e-80	263	396	0.212	0.374	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
9	O15389	1.92e-79	265	551	0.267	0.338	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
10	Q9Y336	8.16e-77	256	463	0.215	0.324	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
11	Q91Y57	9.65e-76	253	467	0.204	0.304	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
12	O43699	7.20e-74	248	453	0.209	0.322	SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 OS=Homo sapiens OX=9606 GN=SIGLEC6 PE=1 SV=2
13	P20138	1.29e-67	228	364	0.159	0.305	CD33_HUMAN Myeloid cell surface antigen CD33 OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=2
14	Q546G0	1.29e-67	228	364	0.159	0.305	Q546G0_HUMAN CD33 antigen (Gp67) OS=Homo sapiens OX=9606 GN=CD33 PE=4 SV=1
15	Q920G3	1.28e-65	229	569	0.214	0.262	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
16	A0A0R4IQ16	3.72e-50	187	635	0.231	0.254	A0A0R4IQ16_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
17	G3X9N0	1.51e-49	177	293	0.143	0.341	G3X9N0_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=4 SV=1
18	F1QSA4	1.57e-49	186	653	0.231	0.247	F1QSA4_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
19	Q3Y597	2.03e-49	177	309	0.148	0.333	Q3Y597_MOUSE SIGLEC-H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
20	Q4QQK7	2.29e-49	177	309	0.148	0.333	Q4QQK7_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.1e-06	39.9	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	1.5e-19	81.1	Immunoglobulin I-set domain
3	PF00047 ig	6.6e-14	63.2	Immunoglobulin domain
4	PF13895 Ig_2	2.2e-24	96.9	Immunoglobulin domain
5	PF13927 Ig_3	4.4e-22	89.7	Immunoglobulin domain
6	PF17736 Ig_C17orf99	1.1e+02	14.3	C17orf99 Ig domain
7	PF07686 V-set	1.2e-13	62.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483985	0.985	Signal transducer CD24
2	9606.ENSP00000363330	0.927	CAMPATH-1 antigen
3	9606.ENSP00000312326	0.761	Membrane primary amine oxidase
4	9606.ENSP00000345347	0.755	High mobility group protein B1
5	9606.ENSP00000340944	0.527	Tyrosine-protein phosphatase non-receptor type 11
6	9606.ENSP00000379980	0.516	B-cell differentiation antigen CD72

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.960	enzyme binding
GO:0019902	0.644	phosphatase binding
GO:0042169	0.456	SH2 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048583	0.967	regulation of response to stimulus
GO:0009987	0.902	cellular process
GO:0031347	0.902	regulation of defense response
GO:0032101	0.886	regulation of response to external stimulus
GO:0050794	0.873	regulation of cellular process
GO:0048519	0.841	negative regulation of biological process
GO:0048518	0.772	positive regulation of biological process
GO:0002682	0.702	regulation of immune system process
GO:0050896	0.699	response to stimulus
GO:0019222	0.670	regulation of metabolic process
GO:0048585	0.652	negative regulation of response to stimulus
GO:0051239	0.620	regulation of multicellular organismal process
GO:0060255	0.620	regulation of macromolecule metabolic process
GO:0050727	0.609	regulation of inflammatory response
GO:0048584	0.596	positive regulation of response to stimulus
GO:1903034	0.538	regulation of response to wounding
GO:0051240	0.490	positive regulation of multicellular organismal process
GO:0032102	0.457	negative regulation of response to external stimulus
GO:0009893	0.448	positive regulation of metabolic process
GO:0050776	0.419	regulation of immune response
GO:0010468	0.416	regulation of gene expression
GO:0048522	0.405	positive regulation of cellular process
GO:0023051	0.404	regulation of signaling
GO:0010646	0.403	regulation of cell communication
GO:0001817	0.396	regulation of cytokine production
GO:0009966	0.393	regulation of signal transduction
GO:0010604	0.375	positive regulation of macromolecule metabolic process
GO:0032502	0.374	developmental process
GO:0002831	0.357	regulation of response to biotic stimulus
GO:0023052	0.354	signaling
GO:0051716	0.352	cellular response to stimulus
GO:0032103	0.350	positive regulation of response to external stimulus
GO:0032501	0.339	multicellular organismal process
GO:0050865	0.328	regulation of cell activation
GO:0002833	0.306	positive regulation of response to biotic stimulus
GO:0031349	0.306	positive regulation of defense response
GO:0051249	0.302	regulation of lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.962	intracellular anatomical structure
GO:0005737	0.949	cytoplasm
GO:0043226	0.948	organelle
GO:0012505	0.946	endomembrane system
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0031982	0.888	vesicle
GO:0031410	0.836	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]