StarFunc result for job id Q96LC9

User Input

>input (184 residues)
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
AGPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LC9	0.999	0.999	3.053E-28	184	1.000	1.000	Q96LC9.pdb.gz	BMF_HUMAN Bcl-2-modifying factor OS=Homo sapiens OX=9606 GN=BMF PE=1 SV=1
2	AFDB:Q8K589	0.381	0.379	1.322E-22	185	0.875	0.870	Q8K589.pdb.gz	BMF_RAT Bcl-2-modifying factor OS=Rattus norvegicus OX=10116 GN=Bmf PE=2 SV=1
3	AFDB:Q6UXG3	0.257	0.156	3.611E-1	332	0.207	0.114	Q6UXG3.pdb.gz	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
4	AFDB:Q9V472	0.216	0.095	3.611E-1	505	0.201	0.073	Q9V472.pdb.gz	Q9V472_DROME DLim1 OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=1 SV=1
5	AFDB:Q5RH85	0.306	0.095	3.876E-1	653	0.174	0.049	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
6	AFDB:O14026	0.236	0.061	4.467E-1	798	0.130	0.030	O14026.pdb.gz	SET2_SCHPO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set2 PE=1 SV=1
7	AFDB:P26343	0.279	0.205	4.795E-1	269	0.114	0.078	P26343.pdb.gz	DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAL80 PE=2 SV=1
8	AFDB:P33417	0.252	0.090	5.932E-1	597	0.174	0.054	P33417.pdb.gz	IXR1_YEAST Intrastrand cross-link recognition protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IXR1 PE=1 SV=2
9	AFDB:Q4WQC6	0.297	0.113	5.932E-1	499	0.152	0.056	Q4WQC6.pdb.gz	Q4WQC6_ASPFU Myosin heavy chain OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12350 PE=4 SV=1
10	AFDB:A2ABH1	0.291	0.086	6.835E-1	729	0.141	0.036	A2ABH1.pdb.gz	A2ABH1_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 GN=CCHCR1 PE=1 SV=1
11	PDB:3j79F	0.179	0.092	6.522	390	0.065	0.031	3j79F.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
12	PDB:3jb9M	0.143	0.127	7.516	207	0.087	0.077	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
13	PDB:6rlbD	0.089	0.047	8.068	446	0.087	0.036	6rlbD.pdb.gz
14	PDB:6gmlU	0.147	0.148	8.661	183	0.049	0.049	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
15	PDB:7d59Q	0.101	0.140	9.981	121	0.087	0.132	7d59Q.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LC9	3.70e-134	374	184	1.000	1.000	BMF_HUMAN Bcl-2-modifying factor OS=Homo sapiens OX=9606 GN=BMF PE=1 SV=1
2	Q91ZE9	4.45e-114	323	185	0.875	0.870	BMF_MOUSE Bcl-2-modifying factor OS=Mus musculus OX=10090 GN=Bmf PE=1 SV=1
3	Q8K589	2.69e-113	322	185	0.875	0.870	BMF_RAT Bcl-2-modifying factor OS=Rattus norvegicus OX=10116 GN=Bmf PE=2 SV=1
4	U3JAJ5	4.65e-06	47.4	208	0.190	0.168	U3JAJ5_DANRE BCL2-modifying factor 2 OS=Danio rerio OX=7955 GN=si:ch211-119b12.7 PE=4 SV=1
5	Q0GKC7	2.37e-05	44.7	142	0.207	0.268	Q0GKC7_DANRE Bcl-2-modifying factor OS=Danio rerio OX=7955 GN=bmf1 PE=2 SV=1
6	Q0GKC4	4.56e-04	41.6	226	0.174	0.142	Q0GKC4_DANRE BCL2-modifying factor 2 OS=Danio rerio OX=7955 GN=si:ch211-119b12.7 PE=2 SV=1
7	Q9I1X7	2.7	30.8	840	0.087	0.019	LIGD_PSEAE Multifunctional non-homologous end joining protein LigD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ligD PE=1 SV=1
8	Q9C8K2	5.3	30.0	687	0.120	0.032	AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana OX=3702 GN=ABCG12 PE=1 SV=1
9	G7IBJ4	6.5	29.6	710	0.103	0.027	CN15A_MEDTR Protein CNGC15a OS=Medicago truncatula OX=3880 GN=CNGC15A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15185 BMF	4.9e-66	233.7	Bcl-2-modifying factor, apoptosis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346697

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.992	Bcl-2-like protein 1
2	9606.ENSP00000358022	0.976	Induced myeloid leukemia cell differentiation protein Mcl-1
3	9606.ENSP00000477310	0.953	Dynein light chain 2, cytoplasmic
4	9606.ENSP00000267953	0.947	Bcl-2-related protein A1
5	9606.ENSP00000378974	0.944	Mitogen-activated protein kinase 8
6	9606.ENSP00000250405	0.920	Bcl-2-like protein 2
7	9606.ENSP00000381185	0.879	Apoptosis regulator Bcl-2
8	9606.ENSP00000376943	0.861	Bcl-2-like protein 11
9	9606.ENSP00000257572	0.852	Activator of apoptosis harakiri
10	9606.ENSP00000452479	0.833	BCL2L2-PABPN1 readthrough
11	9606.ENSP00000216115	0.812	Bcl-2-interacting killer
12	9606.ENSP00000326119	0.811	Phorbol-12-myristate-13-acetate-induced protein 1
13	9606.ENSP00000376297	0.783	Dynein light chain 1, cytoplasmic
14	9606.ENSP00000384924	0.737	Protein Bop
15	9606.ENSP00000260442	0.681	Bcl-2-like protein 10
16	9606.ENSP00000307786	0.621	Cytochrome c
17	9606.ENSP00000404503	0.615	Bcl-2-binding component 3
18	9606.ENSP00000363591	0.610	Bcl-2 homologous antagonist/killer
19	9606.ENSP00000307305	0.604	DNA damage-inducible transcript 4 protein
20	9606.ENSP00000448165	0.576	Apoptotic protease-activating factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0051716	0.991	cellular response to stimulus
GO:0048519	0.988	negative regulation of biological process
GO:0019222	0.987	regulation of metabolic process
GO:0048518	0.985	positive regulation of biological process
GO:0048523	0.983	negative regulation of cellular process
GO:0048522	0.983	positive regulation of cellular process
GO:0104004	0.982	cellular response to environmental stimulus
GO:0009314	0.980	response to radiation
GO:0010506	0.979	regulation of autophagy
GO:0042981	0.978	regulation of apoptotic process
GO:0071214	0.965	cellular response to abiotic stimulus
GO:0009411	0.957	response to UV
GO:0009892	0.953	negative regulation of metabolic process
GO:0043065	0.952	positive regulation of apoptotic process
GO:0031324	0.944	negative regulation of cellular metabolic process
GO:0006915	0.940	apoptotic process
GO:0071478	0.921	cellular response to radiation
GO:0010507	0.911	negative regulation of autophagy
GO:0071482	0.878	cellular response to light stimulus
GO:0007154	0.859	cell communication
GO:0034644	0.829	cellular response to UV
GO:0048583	0.772	regulation of response to stimulus
GO:0023051	0.771	regulation of signaling
GO:0010646	0.750	regulation of cell communication
GO:0009966	0.631	regulation of signal transduction
GO:0006950	0.566	response to stress
GO:0051128	0.543	regulation of cellular component organization
GO:0033554	0.538	cellular response to stress
GO:0033043	0.488	regulation of organelle organization
GO:0009893	0.479	positive regulation of metabolic process
GO:0048584	0.473	positive regulation of response to stimulus
GO:0043069	0.469	negative regulation of programmed cell death
GO:0043066	0.461	negative regulation of apoptotic process
GO:0009967	0.460	positive regulation of signal transduction
GO:2001233	0.433	regulation of apoptotic signaling pathway
GO:0060255	0.389	regulation of macromolecule metabolic process
GO:0007165	0.353	signal transduction
GO:1902531	0.351	regulation of intracellular signal transduction
GO:0051171	0.349	regulation of nitrogen compound metabolic process
GO:0080090	0.348	regulation of primary metabolic process
GO:0090199	0.337	regulation of release of cytochrome c from mitochondria
GO:0010822	0.334	positive regulation of mitochondrion organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.981	cytosol
GO:0016020	0.951	membrane
GO:0005739	0.940	mitochondrion
GO:0032991	0.881	protein-containing complex
GO:0031090	0.855	organelle membrane
GO:0098588	0.840	bounding membrane of organelle
GO:0031966	0.835	mitochondrial membrane
GO:0071944	0.830	cell periphery
GO:0005886	0.818	plasma membrane
GO:0031968	0.787	organelle outer membrane
GO:0005741	0.769	mitochondrial outer membrane
GO:0005634	0.727	nucleus
GO:0043232	0.628	intracellular non-membrane-bounded organelle
GO:0012505	0.614	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]