StarFunc result for job id Q96LI5

User Input

>input (555 residues)
MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTA
LHLNDNYLSRIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYE
LGRLFQLQTLGLKGNPLSQDILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKER
DQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQE
VETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAH
MHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV
EYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNY
TFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHP
PLLPLVNGVHLPNRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VEG6	0.954	0.954	0.000	555	0.980	0.980	Q8VEG6.pdb.gz	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
2	AFDB:Q9ULM6	0.928	0.925	3.019E-98	557	0.787	0.785	Q9ULM6.pdb.gz	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
3	PDB:7ax1A	0.631	0.673	3.594E-82	518	0.751	0.805	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
4	AFDB:Q8IMX1	0.900	0.882	1.006E-80	567	0.568	0.556	Q8IMX1.pdb.gz	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
5	AFDB:Q9U1P4	0.897	0.815	1.331E-77	613	0.505	0.457	Q9U1P4.pdb.gz	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
6	AFDB:O74874	0.788	0.641	7.051E-60	690	0.398	0.320	O74874.pdb.gz	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
7	AFDB:P31384	0.757	0.515	4.424E-53	837	0.323	0.214	P31384.pdb.gz	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
8	AFDB:Q8W0Z9	0.565	0.523	7.049E-35	602	0.231	0.213	Q8W0Z9.pdb.gz	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
9	AFDB:F4J8R6	0.501	0.614	9.245E-29	449	0.202	0.249	F4J8R6.pdb.gz	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
10	AFDB:A0A024R6B2	0.513	0.428	2.625E-28	670	0.198	0.164	A0A024R6B2.pdb.gz
11	AFDB:A8MS41	0.489	0.643	8.367E-28	417	0.184	0.245	A8MS41.pdb.gz	CCR4D_ARATH Carbon catabolite repressor protein 4 homolog 4 OS=Arabidopsis thaliana OX=3702 GN=CCR4-4 PE=1 SV=1
12	PDB:7voiC	0.282	0.855	1.250E-22	180	0.285	0.878	7voiC.pdb.gz
13	PDB:4f1iA	0.326	0.522	3.365E-11	328	0.090	0.152	4f1iA.pdb.gz
14	PDB:1akoA	0.289	0.542	1.636E-9	268	0.081	0.168	1akoA.pdb.gz
15	PDB:2j63A	0.311	0.477	5.617E-8	333	0.085	0.141	2j63A.pdb.gz
16	PDB:7cd5A	0.299	0.531	8.428E-8	278	0.095	0.191	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
17	PDB:7lt9A	0.182	0.395	8.428E-8	251	0.074	0.163	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
18	PDB:2a3zB	0.309	0.584	1.420E-7	260	0.076	0.162	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
19	PDB:7kiuA	0.297	0.549	2.011E-7	263	0.074	0.156	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
20	PDB:4awnA	0.313	0.590	2.687E-7	260	0.074	0.158	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y9C1	0.0	898	435	0.782	0.998	H0Y9C1_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
2	H0Y9Z5	0.0	1142	550	0.991	1.000	H0Y9Z5_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
3	Q7K112	0.0	641	552	0.566	0.569	Q7K112_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
4	Q8IMX1	0.0	642	567	0.566	0.554	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
5	Q8MTZ5	0.0	630	566	0.566	0.555	Q8MTZ5_DROME poly(A)-specific ribonuclease (Fragment) OS=Drosophila melanogaster OX=7227 GN=twin PE=2 SV=1
6	Q8VEG6	0.0	1132	555	0.980	0.980	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
7	Q96LI5	0.0	1153	555	1.000	1.000	CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
8	Q9U1P4	0.0	569	613	0.492	0.445	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
9	Q9ULM6	0.0	912	557	0.787	0.785	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
10	Q9VCB6	0.0	642	545	0.566	0.576	Q9VCB6_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=2
11	Q8IMX0	4.44e-150	436	358	0.380	0.589	Q8IMX0_DROME Twin, isoform D OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
12	O74874	1.97e-125	385	690	0.400	0.322	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
13	P31384	7.14e-92	301	837	0.315	0.209	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
14	Q8W0Z9	2.97e-49	181	602	0.231	0.213	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
15	Q08DF7	4.80e-34	138	609	0.178	0.163	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1
16	Q6L8Q7	3.10e-33	136	609	0.177	0.161	PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2
17	Q3TIU4	3.93e-32	132	608	0.178	0.163	PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus OX=10090 GN=Pde12 PE=1 SV=2
18	F4J8R6	9.34e-28	118	449	0.198	0.245	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
19	Q9UNK9	2.43e-24	109	670	0.132	0.109	ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens OX=9606 GN=ANGEL1 PE=1 SV=1
20	Q5VTE6	2.41e-23	105	544	0.123	0.125	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	2.5e-18	78.1	Endonuclease/Exonuclease/phosphatase family
2	PF00560 LRR_1	2.6e+02	13.6	Leucine Rich Repeat
3	PF12799 LRR_4	0.0008	31.0	Leucine Rich repeats (2 copies)
4	PF13855 LRR_8	3.3e-08	44.5	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006059530.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006080217.1	0.997	CCR4-NOT transcription complex subunit 7
2	89462.XP_006048216.1	0.995	Cell differentiation protein RCD1 homolog
3	89462.XP_006053525.1	0.995	CCR4-NOT transcription complex subunit 3
4	89462.XP_006058465.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns
5	89462.XP_006076055.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
6	89462.XP_006052526.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns
7	89462.XP_006071157.1	0.991	CCR4-NOT transcription complex subunit 1-like
8	89462.XP_006079915.1	0.991	CCR4-NOT transcription complex subunit 4 isoform X1
9	89462.XP_006080810.1	0.991	CCR4-NOT transcription complex subunit 6 isoform X1
10	89462.XP_006071995.1	0.990	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
11	89462.XP_006079654.1	0.983	CCR4-NOT transcription complex subunit 10 isoform X1
12	89462.XP_006080777.1	0.976	182 kDa tankyrase-1-binding protein isoform X1
13	89462.XP_006070225.1	0.969	Protein Tob1
14	89462.XP_006073757.1	0.918	Cytoplasmic polyadenylation element-binding protein 3 isoform X1
15	89462.XP_006046490.1	0.861	Polyadenylate-binding protein 1 isoform X1
16	89462.XP_006049486.1	0.848	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
17	89462.XP_006077591.1	0.848	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
18	89462.XP_006059303.1	0.845	Polyadenylate-binding protein 1-like isoform X1
19	89462.XP_006064146.1	0.811	Trinucleotide repeat-containing gene 6C protein isoform X1
20	89462.XP_006045650.1	0.766	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004535	1.000	poly(A)-specific ribonuclease activity
GO:0003713	0.344	transcription coactivator activity
GO:0030374	0.310	nuclear receptor coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.996	cellular process
GO:0048522	0.993	positive regulation of cellular process
GO:0010468	0.993	regulation of gene expression
GO:0048523	0.990	negative regulation of cellular process
GO:0010556	0.990	regulation of macromolecule biosynthetic process
GO:0031326	0.990	regulation of cellular biosynthetic process
GO:0010605	0.990	negative regulation of macromolecule metabolic process
GO:0044238	0.988	primary metabolic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0051172	0.982	negative regulation of nitrogen compound metabolic process
GO:0031324	0.982	negative regulation of cellular metabolic process
GO:0051252	0.979	regulation of RNA metabolic process
GO:0051246	0.975	regulation of protein metabolic process
GO:0044237	0.973	cellular metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0010604	0.972	positive regulation of macromolecule metabolic process
GO:0051173	0.967	positive regulation of nitrogen compound metabolic process
GO:0031325	0.967	positive regulation of cellular metabolic process
GO:0065008	0.964	regulation of biological quality
GO:0010608	0.964	post-transcriptional regulation of gene expression
GO:0044260	0.963	cellular macromolecule metabolic process
GO:0010629	0.963	negative regulation of gene expression
GO:0051248	0.963	negative regulation of protein metabolic process
GO:0016070	0.963	RNA metabolic process
GO:0051254	0.961	positive regulation of RNA metabolic process
GO:0031327	0.958	negative regulation of cellular biosynthetic process
GO:0010558	0.957	negative regulation of macromolecule biosynthetic process
GO:0031329	0.956	regulation of cellular catabolic process
GO:0006417	0.945	regulation of translation
GO:0061014	0.945	positive regulation of mRNA catabolic process
GO:0000288	0.938	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0042127	0.847	regulation of cell population proliferation
GO:0008284	0.429	positive regulation of cell population proliferation
GO:0000289	0.318	nuclear-transcribed mRNA poly(A) tail shortening

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.925	intracellular organelle
GO:0032991	0.915	protein-containing complex
GO:0043227	0.908	membrane-bounded organelle
GO:0005634	0.891	nucleus
GO:0030014	0.585	CCR4-NOT complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.4	1.000	poly(A)-specific ribonuclease.

[back to server]