StarFunc result for job id Q96LL9

User Input

>input (226 residues)
MAAMRWRWWQRLLPWRLLQARGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTA
TQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDL
RGPGVRPSRTPAPDPGSPRTPPPTSRTHDGSRASPGANRTMFNFDAFYQAHYGEQLERER
RLRARREALRKRQEYRSMKGLRWEDTRDTAAIFLIFSIFIIIGFYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LL9	1.000	1.000	4.985E-34	226	1.000	1.000	Q96LL9.pdb.gz	DJC30_HUMAN DnaJ homolog subfamily C member 30, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJC30 PE=1 SV=3
2	AFDB:P59041	0.356	0.368	3.816E-22	219	0.681	0.703	P59041.pdb.gz	DJC30_MOUSE DnaJ homolog subfamily C member 30, mitochondrial OS=Mus musculus OX=10090 GN=Dnajc30 PE=1 SV=1
3	AFDB:Q9NNZ3	0.298	0.282	4.878E-7	241	0.283	0.266	Q9NNZ3.pdb.gz	DNJC4_HUMAN DnaJ homolog subfamily C member 4 OS=Homo sapiens OX=9606 GN=DNAJC4 PE=1 SV=1
4	AFDB:P92029	0.298	0.310	5.805E-7	217	0.177	0.184	P92029.pdb.gz	DNJ60_DROME DnaJ-like protein 60 OS=Drosophila melanogaster OX=7227 GN=DnaJ-60 PE=2 SV=1
5	AFDB:Q27237	0.285	0.131	1.307E-6	520	0.204	0.088	Q27237.pdb.gz	TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG5504 PE=1 SV=2
6	AFDB:P35191	0.292	0.134	1.468E-6	511	0.204	0.090	P35191.pdb.gz	MDJ1_YEAST DnaJ homolog 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDJ1 PE=1 SV=1
7	AFDB:Q53G26	0.305	0.149	1.961E-6	480	0.177	0.083	Q53G26.pdb.gz	Q53G26_HUMAN DnaJ (Hsp40) homolog, subfamily A, member 3 variant (Fragment) OS=Homo sapiens OX=9606 GN=DNAJA3 PE=2 SV=1
8	AFDB:G3V6I5	0.289	0.156	2.473E-6	429	0.199	0.105	G3V6I5.pdb.gz	G3V6I5_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=1 SV=2
9	AFDB:Q9D844	0.288	0.267	3.933E-6	244	0.226	0.209	Q9D844.pdb.gz	DNJC4_MOUSE DnaJ homolog subfamily C member 4 OS=Mus musculus OX=10090 GN=Dnajc4 PE=2 SV=2
10	AFDB:A0A0G2K5E4	0.288	0.139	5.901E-6	480	0.204	0.096	A0A0G2K5E4.pdb.gz	A0A0G2K5E4_RAT DnaJ heat shock protein family (Hsp40) member A3 OS=Rattus norvegicus OX=10116 GN=Dnaja3 PE=3 SV=1
11	PDB:6byrA	0.269	0.152	1.141E-2	405	0.115	0.064	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.262	0.228	3.856E-2	262	0.111	0.095	7x3kA.pdb.gz
13	PDB:2l6lA	0.214	0.291	8.193E-2	155	0.106	0.155	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
14	PDB:1fpoA	0.255	0.329	9.200E-2	171	0.080	0.105	1fpoA.pdb.gz
15	PDB:2y4uA	0.223	0.122	4.664E-1	424	0.080	0.042	2y4uA.pdb.gz
16	PDB:7pntL	0.181	0.228	9.352E-1	176	0.088	0.114	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:7d5sRN	0.190	0.078	2.365	607	0.097	0.036	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:7l08AL	0.182	0.232	2.365	174	0.088	0.115	7l08AL.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
19	PDB:3jd5O	0.178	0.228	2.814	173	0.088	0.116	3jd5O.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
20	PDB:6o4oA	0.135	0.170	2.814	169	0.115	0.154	6o4oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LL9	1.18e-166	460	226	1.000	1.000	DJC30_HUMAN DnaJ homolog subfamily C member 30, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJC30 PE=1 SV=3
2	P59041	1.80e-80	241	219	0.681	0.703	DJC30_MOUSE DnaJ homolog subfamily C member 30, mitochondrial OS=Mus musculus OX=10090 GN=Dnajc30 PE=1 SV=1
3	P40564	5.55e-13	69.3	432	0.146	0.076	DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DJP1 PE=1 SV=1
4	Q57WJ9	3.99e-12	67.0	481	0.142	0.067	Q57WJ9_TRYB2 Chaperone protein DnaJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.330 PE=4 SV=1
5	Q380Y9	1.64e-11	64.7	308	0.137	0.101	Q380Y9_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8750 PE=4 SV=1
6	Q10209	1.68e-11	65.1	392	0.137	0.079	YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.01 PE=1 SV=1
7	Q9HGM9	1.79e-11	65.1	476	0.119	0.057	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
8	Q38C15	2.38e-11	64.7	416	0.146	0.079	Q38C15_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5440 PE=3 SV=1
9	P25491	3.77e-11	63.9	409	0.142	0.078	MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDJ1 PE=1 SV=1
10	Q03751	6.44e-11	62.4	249	0.119	0.108	DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster OX=7227 GN=Csp PE=1 SV=1
11	P31689	8.08e-11	63.2	397	0.137	0.078	DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2
12	P60904	1.21e-10	60.8	198	0.128	0.146	DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus OX=10090 GN=Dnajc5 PE=1 SV=1
13	P60905	1.21e-10	60.8	198	0.128	0.146	DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Dnajc5 PE=1 SV=1
14	Q9H3Z4	1.33e-10	60.8	198	0.128	0.146	DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1
15	Q29455	1.42e-10	60.8	198	0.128	0.146	DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus OX=9913 GN=DNAJC5 PE=1 SV=1
16	Q9LZK5	1.72e-10	62.0	346	0.124	0.081	DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana OX=3702 GN=ERDJ3B PE=1 SV=1
17	P63036	1.77e-10	62.0	397	0.133	0.076	DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Dnaja1 PE=1 SV=1
18	P63037	1.77e-10	62.0	397	0.133	0.076	DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus OX=10090 GN=Dnaja1 PE=1 SV=1
19	Q9QYI6	1.97e-10	60.8	222	0.119	0.122	DNJB9_MOUSE DnaJ homolog subfamily B member 9 OS=Mus musculus OX=10090 GN=Dnajb9 PE=1 SV=2
20	Q53G26	2.05e-10	62.0	480	0.119	0.056	Q53G26_HUMAN DnaJ (Hsp40) homolog, subfamily A, member 3 variant (Fragment) OS=Homo sapiens OX=9606 GN=DNAJA3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	1.2e-16	71.9	DnaJ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378605

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301457	0.684	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
2	9606.ENSP00000346196	0.677	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
3	9606.ENSP00000378328	0.644	Ankyrin repeat domain-containing protein 13B
4	9606.ENSP00000401191	0.616	Probable 18S rRNA (guanine-N(7))-methyltransferase
5	9606.ENSP00000316775	0.602	Transmembrane protein 270
6	9606.ENSP00000331474	0.589	Synapse differentiation-inducing gene protein 1-like
7	9606.ENSP00000222800	0.583	Protein ABHD11
8	9606.ENSP00000398597	0.564	Exosome complex component MTR3
9	9606.ENSP00000360532	0.543	Cell division cycle 5-like protein
10	9606.ENSP00000307260	0.519	Transducin beta-like protein 2
11	9606.ENSP00000480364	0.516	RCC1-like G exchanging factor-like protein
12	9606.ENSP00000309126	0.514	Probable 28S rRNA (cytosine-C(5))-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0019222	0.840	regulation of metabolic process
GO:0031323	0.813	regulation of cellular metabolic process
GO:0080090	0.792	regulation of primary metabolic process
GO:0051171	0.789	regulation of nitrogen compound metabolic process
GO:0031326	0.747	regulation of cellular biosynthetic process
GO:0019219	0.741	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.705	multicellular organismal process
GO:0009987	0.694	cellular process
GO:0032502	0.575	developmental process
GO:0048856	0.565	anatomical structure development
GO:0019220	0.536	regulation of phosphate metabolic process
GO:0007275	0.523	multicellular organism development
GO:0006140	0.417	regulation of nucleotide metabolic process
GO:0048731	0.404	system development
GO:1900542	0.397	regulation of purine nucleotide metabolic process
GO:0048513	0.391	animal organ development
GO:1903578	0.389	regulation of ATP metabolic process
GO:0030808	0.385	regulation of nucleotide biosynthetic process
GO:0060322	0.366	head development
GO:0007417	0.359	central nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0016020	0.976	membrane
GO:0031090	0.958	organelle membrane
GO:0031967	0.950	organelle envelope
GO:0031966	0.939	mitochondrial membrane
GO:0005743	0.900	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]