StarFunc result for job id Q96LM9

User Input

>input (149 residues)
MLSGPHPSPTFRPNPCPWPCLHSLWMEISPTQLCFLSPGPSPQSPSCCFQGMNSGSELGK
LWRKLFKGIPRLSVSHFDFYCGTCVLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQ
LEMLLRKLSDLVWTSDALSDKILEDGLVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LM9	1.000	1.000	3.404E-29	149	1.000	1.000	Q96LM9.pdb.gz	CT173_HUMAN Uncharacterized protein C20orf173 OS=Homo sapiens OX=9606 GN=C20orf173 PE=1 SV=1
2	AFDB:Q2WG77	0.234	0.184	1.709E-1	201	0.128	0.095	Q2WG77.pdb.gz	RIPP1_MOUSE Protein ripply1 OS=Mus musculus OX=10090 GN=Ripply1 PE=2 SV=1
3	AFDB:Q0D2K3	0.174	0.172	1.651	151	0.114	0.113	Q0D2K3.pdb.gz	RIPP1_HUMAN Protein ripply1 OS=Homo sapiens OX=9606 GN=RIPPLY1 PE=1 SV=1
4	PDB:3t1tA	0.130	0.113	1.707	193	0.054	0.041	3t1tA.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
5	AFDB:M3VX86	0.197	0.150	2.030	198	0.188	0.141	M3VX86.pdb.gz	M3VX86_FELCA Corticotropin releasing hormone OS=Felis catus OX=9685 GN=CRH PE=3 SV=1
6	AFDB:Q05753	0.200	0.075	3.066	435	0.161	0.055	Q05753.pdb.gz	AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AKRP PE=1 SV=2
7	PDB:5faiA	0.186	0.144	3.169	209	0.074	0.053	5faiA.pdb.gz	EMG1 N1-Specific Pseudouridine Methyltransferase
8	AFDB:E9QDZ4	0.200	0.165	3.768	183	0.101	0.082	E9QDZ4.pdb.gz
9	PDB:3bt7A	0.166	0.072	3.894	369	0.040	0.016	3bt7A.pdb.gz	Structure of a TrmA-RNA complex: A consensus RNA fold contributes to substrate selectivity and catalysis in m5U methyltransferases.
10	AFDB:Q75KV9	0.216	0.135	4.323	299	0.114	0.057	Q75KV9.pdb.gz	BH148_ORYSJ Transcription factor BHLH148 OS=Oryza sativa subsp. japonica OX=39947 GN=BHLH148 PE=1 SV=1
11	PDB:1qo0E	0.198	0.157	4.468	194	0.054	0.041	1qo0E.pdb.gz	Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex
12	AFDB:B9DHG0	0.202	0.105	4.630	301	0.181	0.090	B9DHG0.pdb.gz	PYG7_ARATH Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYG7 PE=1 SV=1
13	PDB:1gxdC	0.101	0.084	4.786	192	0.040	0.031	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
14	PDB:2ancF	0.167	0.164	4.786	153	0.094	0.092	2ancF.pdb.gz
15	PDB:7t02A	0.170	0.023	4.786	1752	0.101	0.009	7t02A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
16	PDB:3n75A	0.151	0.042	5.127	711	0.060	0.013	3n75A.pdb.gz	Linkage between the bacterial acid stress and stringent responses: the structure of the inducible lysine decarboxylase.
17	AFDB:Q21148	0.207	0.105	5.313	308	0.141	0.068	Q21148.pdb.gz	ZIP2_CAEEL Transcription factor zip-2 OS=Caenorhabditis elegans OX=6239 GN=zip-2 PE=1 SV=2
18	AFDB:Q8VYY8	0.122	0.072	5.313	274	0.188	0.102	Q8VYY8.pdb.gz	Q8VYY8_ARATH Nucleusenvelope protein OS=Arabidopsis thaliana OX=3702 GN=At2g43630 PE=1 SV=1
19	PDB:2d1pB	0.091	0.113	7.229	119	0.027	0.034	2d1pB.pdb.gz
20	PDB:3czpA	0.149	0.056	8.885	466	0.094	0.030	3czpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LM9	1.18e-106	302	149	1.000	1.000	CT173_HUMAN Uncharacterized protein C20orf173 OS=Homo sapiens OX=9606 GN=C20orf173 PE=1 SV=1
2	Q08BF4	0.042	35.4	382	0.168	0.065	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
3	Q9Y274	0.55	32.3	331	0.121	0.054	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
4	Q7Z699	0.83	32.0	444	0.148	0.050	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2
5	Q11206	1.5	30.8	333	0.087	0.039	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
6	Q02734	1.6	30.8	374	0.087	0.035	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
7	P97325	1.7	30.8	374	0.087	0.035	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
8	Q8NAX2	1.8	30.8	398	0.154	0.058	KDF1_HUMAN Keratinocyte differentiation factor 1 OS=Homo sapiens OX=9606 GN=KDF1 PE=1 SV=2
9	Q5SQS8	2.1	30.4	335	0.081	0.036	CJ120_HUMAN Uncharacterized protein C10orf120 OS=Homo sapiens OX=9606 GN=C10orf120 PE=1 SV=1
10	A0A0R4IBK5	3.2	30.4	5209	0.154	0.004	R213A_DANRE E3 ubiquitin-protein ligase rnf213-alpha OS=Danio rerio OX=7955 GN=rnf213a PE=3 SV=1
11	B0CN48	3.2	30.0	374	0.087	0.035	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
12	P61131	4.2	29.6	333	0.087	0.039	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
13	Q91Y74	4.5	29.6	333	0.087	0.039	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
14	F1NP39	4.7	29.6	672	0.195	0.043	F1NP39_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD3 PE=1 SV=1
15	O57400	4.7	29.6	672	0.195	0.043	O57400_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 PE=2 SV=1
16	Q11203	4.8	29.6	375	0.074	0.029	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
17	Q9UNP4	5.3	29.3	418	0.081	0.029	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
18	Q9QZ39	6.7	29.3	526	0.081	0.023	SIA7A_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6galnac1 PE=1 SV=2
19	Q0VEE6	9.6	28.9	662	0.081	0.018	ZN800_MOUSE Zinc finger protein 800 OS=Mus musculus OX=10090 GN=Znf800 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	2	19.5	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000016763

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000000108	0.669	Glucosaminyl (N-acetyl) transferase 4, core 2
2	9555.ENSPANP00000008003	0.669	Glucosaminyl (N-acetyl) transferase 1, core 2
3	9555.ENSPANP00000010762	0.669	Glucosaminyl (N-acetyl) transferase 3, mucin type
4	9555.ENSPANP00000001363	0.668	Hexosyltransferase
5	9555.ENSPANP00000001859	0.668	Hexosyltransferase
6	9555.ENSPANP00000006119	0.663	Glycosyltransferase that generates the core 1 O-glycan Gal- beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins
7	9555.ENSPANP00000008461	0.663	C1GALT1-specific chaperone 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016757	0.938	glycosyltransferase activity
GO:0008373	0.571	sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.386	organic substance metabolic process
GO:0009987	0.372	cellular process
GO:0044237	0.345	cellular metabolic process
GO:0044238	0.341	primary metabolic process
GO:0032501	0.317	multicellular organismal process
GO:1901137	0.307	carbohydrate derivative biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005794	0.944	Golgi apparatus
GO:0016020	0.584	membrane
GO:0000139	0.496	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	0.938	Glycosyltransferases.

[back to server]