StarFunc result for job id Q96LR2

User Input

>input (239 residues)
MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIM
ALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPG
RSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGER
ARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LR2	1.000	1.000	1.454E-36	239	1.000	1.000	Q96LR2.pdb.gz	LURA1_HUMAN Leucine rich adaptor protein 1 OS=Homo sapiens OX=9606 GN=LURAP1 PE=1 SV=1
2	AFDB:D4A8G3	0.406	0.406	1.653E-25	239	0.854	0.854	D4A8G3.pdb.gz	LURA1_RAT Leucine rich adaptor protein 1 OS=Rattus norvegicus OX=10116 GN=Lurap1 PE=1 SV=1
3	AFDB:A0A2R8RS90	0.297	0.259	3.595E-10	286	0.527	0.441	A0A2R8RS90.pdb.gz
4	AFDB:P50538	0.229	0.240	1.235E-1	227	0.159	0.167	P50538.pdb.gz	MAD1_MOUSE Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2
5	AFDB:Q5XI44	0.211	0.164	1.795E-1	323	0.130	0.096	Q5XI44.pdb.gz
6	AFDB:Q9C5J5	0.181	0.140	1.911E-1	319	0.105	0.078	Q9C5J5.pdb.gz	Q9C5J5_ARATH Uncharacterized protein At1g19010 OS=Arabidopsis thaliana OX=3702 GN=At1g19010 PE=1 SV=1
7	AFDB:Q9U213	0.173	0.107	1.911E-1	425	0.176	0.099	Q9U213.pdb.gz	SRRMH_CAEEL SRRM2 protein homolog rsr-2 OS=Caenorhabditis elegans OX=6239 GN=rsr-2 PE=1 SV=1
8	AFDB:Q8NBZ0	0.196	0.192	2.034E-1	244	0.172	0.168	Q8NBZ0.pdb.gz	IN80E_HUMAN INO80 complex subunit E OS=Homo sapiens OX=9606 GN=INO80E PE=1 SV=1
9	AFDB:Q8NHL6	0.119	0.049	2.453E-1	650	0.172	0.063	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	AFDB:Q13227	0.185	0.139	2.779E-1	327	0.146	0.107	Q13227.pdb.gz	GPS2_HUMAN G protein pathway suppressor 2 OS=Homo sapiens OX=9606 GN=GPS2 PE=1 SV=3
11	PDB:7r5jR0	0.139	0.031	5.698	1399	0.092	0.016	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:6t9iE	0.109	0.066	8.819	433	0.142	0.079	6t9iE.pdb.gz
13	PDB:2ndjA	0.097	0.204	9.991	103	0.063	0.146	2ndjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LR2	5.77e-173	477	239	1.000	1.000	LURA1_HUMAN Leucine rich adaptor protein 1 OS=Homo sapiens OX=9606 GN=LURAP1 PE=1 SV=1
2	D4A8G3	1.16e-143	403	239	0.854	0.854	LURA1_RAT Leucine rich adaptor protein 1 OS=Rattus norvegicus OX=10116 GN=Lurap1 PE=1 SV=1
3	A7MC09	5.55e-49	164	286	0.536	0.448	A7MC09_DANRE Leucine rich adaptor protein 1 OS=Danio rerio OX=7955 GN=lurap1 PE=2 SV=1
4	Q8IV03	1.62e-14	72.4	228	0.213	0.224	LUR1L_HUMAN Leucine rich adaptor protein 1-like OS=Homo sapiens OX=9606 GN=LURAP1L PE=1 SV=3
5	A0A126GUP6	0.49	33.9	400	0.142	0.085	MP1_DROME Melanization protease 1 OS=Drosophila melanogaster OX=7227 GN=MP1 PE=1 SV=1
6	G5EDN9	1.7	32.3	1819	0.088	0.012	G5EDN9_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=1
7	P27715	2.1	32.0	2155	0.088	0.010	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
8	O97394	5.8	30.8	2224	0.079	0.009	SDK_DROME Protein sidekick OS=Drosophila melanogaster OX=7227 GN=sdk PE=1 SV=2
9	F4KEY9	6.5	30.4	1065	0.059	0.013	NAA25_ARATH N-terminal acetyltransferase B complex auxiliary subunit NAA25 OS=Arabidopsis thaliana OX=3702 GN=NAA25 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15039 DUF4530	0.19	23.2	Domain of unknown function (DUF4530)
2	PF14854 LURAP	9.9e-50	178.8	Leucine rich adaptor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361048

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437073	0.912	Unconventional myosin-XVIIIa
2	9606.ENSP00000355731	0.910	Serine/threonine-protein kinase MRCK alpha
3	9606.ENSP00000383118	0.861	Cell division control protein 42 homolog
4	9606.ENSP00000197268	0.747	Protein FAM234B
5	9606.ENSP00000394888	0.694	Dedicator of cytokinesis protein 8
6	9606.ENSP00000319464	0.657	Carboxypeptidase N subunit 2
7	9606.ENSP00000356782	0.653	Golgin-45
8	9606.ENSP00000307959	0.622	Dystonin
9	9606.ENSP00000353132	0.600	Diencephalon/mesencephalon homeobox protein 1
10	9606.ENSP00000265070	0.558	Golgi phosphoprotein 3
11	9606.ENSP00000246229	0.509	Zinc finger protein PLAGL2
12	9606.ENSP00000354671	0.506	Microtubule-associated serine/threonine-protein kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.981	cellular process
GO:0050794	0.974	regulation of cellular process
GO:0048518	0.963	positive regulation of biological process
GO:0016043	0.902	cellular component organization
GO:0006996	0.850	organelle organization
GO:0048522	0.800	positive regulation of cellular process
GO:0023051	0.750	regulation of signaling
GO:0010646	0.749	regulation of cell communication
GO:0048583	0.745	regulation of response to stimulus
GO:0009966	0.732	regulation of signal transduction
GO:1902531	0.698	regulation of intracellular signal transduction
GO:0051239	0.688	regulation of multicellular organismal process
GO:0043122	0.581	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0019222	0.486	regulation of metabolic process
GO:0060255	0.484	regulation of macromolecule metabolic process
GO:0010604	0.463	positive regulation of macromolecule metabolic process
GO:0010628	0.372	positive regulation of gene expression
GO:0023056	0.360	positive regulation of signaling
GO:0007010	0.315	cytoskeleton organization
GO:0030036	0.309	actin cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0043227	0.988	membrane-bounded organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0005737	0.981	cytoplasm
GO:0005829	0.969	cytosol
GO:0005856	0.953	cytoskeleton
GO:0015629	0.915	actin cytoskeleton
GO:0042641	0.489	actomyosin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]