StarFunc result for job id Q96LU5

User Input

>input (166 residues)
MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHF
YGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNL
QNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LU5	1.000	1.000	2.151E-31	166	1.000	1.000	Q96LU5.pdb.gz	IMP1L_HUMAN Mitochondrial inner membrane protease subunit 1 OS=Homo sapiens OX=9606 GN=IMMP1L PE=2 SV=1
2	AFDB:Q6NLT8	0.868	0.858	7.037E-17	168	0.386	0.381	Q6NLT8.pdb.gz	IMP1A_ARATH Mitochondrial ATP-independent inner membrane protease subunit 1a OS=Arabidopsis thaliana OX=3702 GN=IMP1A PE=2 SV=1
3	AFDB:O74800	0.788	0.830	3.826E-14	157	0.337	0.357	O74800.pdb.gz	IMP1_SCHPO Mitochondrial inner membrane protease subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=3 SV=1
4	AFDB:Q8BPT6	0.807	0.768	1.494E-13	175	0.295	0.280	Q8BPT6.pdb.gz	IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus OX=10090 GN=Immp2l PE=1 SV=1
5	AFDB:Q9UST2	0.734	0.679	2.352E-13	180	0.295	0.272	Q9UST2.pdb.gz	IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC336.13c PE=3 SV=1
6	AFDB:P28627	0.711	0.625	6.912E-13	190	0.313	0.274	P28627.pdb.gz	IMP1_YEAST Mitochondrial inner membrane protease subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP1 PE=1 SV=3
7	AFDB:P46972	0.815	0.768	1.152E-12	177	0.307	0.288	P46972.pdb.gz	IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP2 PE=1 SV=1
8	AFDB:O04348	0.726	0.370	6.850E-11	340	0.259	0.126	O04348.pdb.gz	TPP1_ARATH Thylakoidal processing peptidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPP1 PE=2 SV=2
9	AFDB:Q8H0W1	0.711	0.419	1.079E-10	291	0.259	0.148	Q8H0W1.pdb.gz	PLSP1_ARATH Chloroplast processing peptidase OS=Arabidopsis thaliana OX=3702 GN=PLSP1 PE=2 SV=2
10	AFDB:Q9I441	0.693	0.645	1.841E-9	179	0.241	0.223	Q9I441.pdb.gz	Q9I441_PSEAE Signal peptidase I OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1303 PE=3 SV=1
11	PDB:4wvhA	0.581	0.199	1.693E-6	519	0.199	0.064	4wvhA.pdb.gz	Peptide binding to a bacterial signal peptidase visualized by peptide tethering and carrier-driven crystallization.
12	PDB:7p2qA	0.438	0.484	1.294E-3	148	0.151	0.169	7p2qA.pdb.gz
13	PDB:7p2pA	0.389	0.428	6.706E-3	148	0.169	0.189	7p2pA.pdb.gz
14	PDB:3bdnA	0.392	0.287	4.362E-2	234	0.133	0.094	3bdnA.pdb.gz	Crystal structure of the lambda repressor and a model for pairwise cooperative operator binding
15	PDB:1jhfA	0.380	0.326	2.393E-1	197	0.120	0.102	1jhfA.pdb.gz
16	PDB:3k3rE	0.330	0.318	3.178E-1	174	0.120	0.115	3k3rE.pdb.gz
17	PDB:5w5eA	0.114	0.113	5.933E-1	167	0.090	0.090	5w5eA.pdb.gz
18	PDB:2zaeA	0.181	0.230	8.339E-1	105	0.084	0.133	2zaeA.pdb.gz	Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
19	PDB:2bmoA	0.136	0.074	9.342E-1	437	0.102	0.039	2bmoA.pdb.gz	Structural insight into the dioxygenation of nitroarene compounds: the crystal structure of nitrobenzene dioxygenase.
20	PDB:4xgtA	0.172	0.040	1.313	961	0.090	0.016	4xgtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LU5	4.27e-123	345	166	1.000	1.000	IMP1L_HUMAN Mitochondrial inner membrane protease subunit 1 OS=Homo sapiens OX=9606 GN=IMMP1L PE=2 SV=1
2	Q9CQU8	1.67e-114	323	166	0.940	0.940	IMP1L_MOUSE Mitochondrial inner membrane protease subunit 1 OS=Mus musculus OX=10090 GN=Immp1l PE=1 SV=1
3	E9PIG6	4.43e-75	221	107	0.645	1.000	E9PIG6_HUMAN Mitochondrial inner membrane protease subunit (Fragment) OS=Homo sapiens OX=9606 GN=IMMP1L PE=1 SV=1
4	E9PNR7	2.70e-66	199	96	0.578	1.000	E9PNR7_HUMAN Mitochondrial inner membrane protease subunit (Fragment) OS=Homo sapiens OX=9606 GN=IMMP1L PE=3 SV=1
5	Q6NLT8	9.52e-39	131	168	0.404	0.399	IMP1A_ARATH Mitochondrial ATP-independent inner membrane protease subunit 1a OS=Arabidopsis thaliana OX=3702 GN=IMP1A PE=2 SV=1
6	O74800	1.04e-31	113	157	0.343	0.363	IMP1_SCHPO Mitochondrial inner membrane protease subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=3 SV=1
7	P28627	5.59e-22	89.4	190	0.325	0.284	IMP1_YEAST Mitochondrial inner membrane protease subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP1 PE=1 SV=3
8	Q96T52	1.21e-20	85.5	175	0.283	0.269	IMP2L_HUMAN Mitochondrial inner membrane protease subunit 2 OS=Homo sapiens OX=9606 GN=IMMP2L PE=1 SV=1
9	Q8BPT6	1.42e-20	85.1	175	0.289	0.274	IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus OX=10090 GN=Immp2l PE=1 SV=1
10	P46972	1.29e-18	80.1	177	0.265	0.249	IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP2 PE=1 SV=1
11	Q9UST2	2.65e-17	77.0	180	0.289	0.267	IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC336.13c PE=3 SV=1
12	Q9I441	4.74e-12	62.8	179	0.247	0.229	Q9I441_PSEAE Signal peptidase I OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1303 PE=3 SV=1
13	O04348	4.18e-10	59.3	340	0.253	0.124	TPP1_ARATH Thylakoidal processing peptidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPP1 PE=2 SV=2
14	Q8H0W1	9.46e-09	55.1	291	0.247	0.141	PLSP1_ARATH Chloroplast processing peptidase OS=Arabidopsis thaliana OX=3702 GN=PLSP1 PE=2 SV=2
15	Q38BE2	4.45e-07	49.7	207	0.313	0.251	Q38BE2_TRYB2 Mitochondrial inner membrane signal peptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2630 PE=4 SV=1
16	Q9I5G7	6.11e-05	44.3	284	0.217	0.127	LEP_PSEAE Signal peptidase I OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lepB PE=3 SV=1
17	P00803	1.15e-04	43.5	324	0.157	0.080	LEP_ECOLI Signal peptidase I OS=Escherichia coli (strain K12) OX=83333 GN=lepB PE=1 SV=2
18	Q84VZ6	3.25e-04	41.6	205	0.193	0.156	IMP2_ARATH Mitochondrial ATP-independent inner membrane protease subunit 2 OS=Arabidopsis thaliana OX=3702 GN=IMP1B PE=2 SV=1
19	P9WKA1	0.002	40.0	294	0.120	0.068	LEP_MYCTU Signal peptidase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lepB PE=1 SV=1
20	Q8RWU2	0.58	32.7	532	0.108	0.034	Q8RWU2_ARATH Immunoglobulin OS=Arabidopsis thaliana OX=3702 GN=LOT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00717 Peptidase_S24	0.13	23.4	Peptidase S24-like
2	PF10502 Peptidase_S26	6.9e-22	89.7	Signal peptidase, peptidase S26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350833	0.855	Metallophosphoesterase MPPED2
2	9606.ENSP00000417548	0.843	DnaJ homolog subfamily C member 24
3	9606.ENSP00000054950	0.790	Reticulocalbin-1
4	9606.ENSP00000379267	0.781	Elongator complex protein 4
5	9606.ENSP00000385936	0.764	Doublecortin domain-containing protein 5
6	9606.ENSP00000367319	0.746	F-box only protein 47
7	9606.ENSP00000270824	0.737	Eva-1 homolog B
8	9606.ENSP00000398495	0.729	Diablo homolog, mitochondrial
9	9606.ENSP00000394510	0.724	Proline-rich protein 12
10	9606.ENSP00000265909	0.708	Sorting nexin-19
11	9606.ENSP00000384966	0.684	Mitochondrial inner membrane protease subunit 2
12	9606.ENSP00000300145	0.681	Mitochondrial inner membrane protease ATP23 homolog
13	9606.ENSP00000249269	0.661	Mitochondrial-processing peptidase subunit beta
14	9606.ENSP00000337816	0.660	Matrix metalloproteinase-25
15	9606.ENSP00000360782	0.658	Mitochondrial-processing peptidase subunit alpha
16	9606.ENSP00000436049	0.657	Eukaryotic translation initiation factor 3 subunit M
17	9606.ENSP00000325421	0.655	Presenilins-associated rhomboid-like protein, mitochondrial
18	9606.ENSP00000470034	0.643	Nitric oxide synthase-interacting protein
19	9606.ENSP00000371051	0.641	Zinc finger ZZ-type and EF-hand domain containing 1
20	9606.ENSP00000361993	0.616	Mitochondrial import inner membrane translocase subunit Tim8 A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005488	0.995	binding
GO:0005515	0.992	protein binding
GO:0004175	0.971	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0051604	0.961	protein maturation
GO:0071702	0.950	organic substance transport
GO:0006508	0.931	proteolysis
GO:0016043	0.871	cellular component organization
GO:0006996	0.848	organelle organization
GO:0045184	0.830	establishment of protein localization
GO:0033365	0.710	protein localization to organelle
GO:0072594	0.665	establishment of protein localization to organelle
GO:0046907	0.595	intracellular transport
GO:0007005	0.479	mitochondrion organization
GO:0071705	0.477	nitrogen compound transport
GO:0044237	0.459	cellular metabolic process
GO:0016485	0.452	protein processing
GO:0006605	0.410	protein targeting
GO:0006839	0.408	mitochondrial transport
GO:0006626	0.367	protein targeting to mitochondrion
GO:0065007	0.325	biological regulation
GO:0050789	0.307	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.852	membrane
GO:0031090	0.666	organelle membrane
GO:0031966	0.436	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]