StarFunc result for job id Q96LU7

User Input

>input (910 residues)
MDVVGENEALQQFFEAQGANGTLENPALDTSLLEEFLGNDFDLGALQRQLPDTPPYSASD
SCSPPQVKGACYPTLRPTAGRTPAPFLHPTAAPAMPPMHPLQSTSGMGDSCQIHGGFHSC
HSNASHLATPLDQSVSSHLGIGCSYPQQPLCHSPGASLPPTKKRKCTQALEDSGECRVWA
CHCRPMTSRSRSSEVQDPDSEGQNRMPTDQCSPALKWQPCHSVPWHSLLNSHYEKLPDVG
YRVVTDKGFNFSPADEAFVCQKKNHFQITIHIQVWGSPKFVETEMGLKPIEMFYLKVFGT
KVEATNQIIAIEQSQADRSKKIFNPVKIDLLADQVTKVTLGRLHFSETTANNMRKKGKPN
PDQRYFMLVVGLYAANQDQFYLLSAHISERIIVRASNPGQFENDSDALWQRGQVPESIVC
HGRVGINTDAPDEALVVCGNMKVMGTIMHPSDSRAKQNIQEVDTNEQLKRIAQMRIVEYD
YKPEFASAMGINTAHQTGMIAQEVQEILPRAVREVGDVTCGNGETLENFLMVDKDQIFME
NVGAVKQLCKLTNNLEERIEELEIWNRKLARLKRLSSWKSSASEASTISKSSRAVSASSP
RRAVHKKNNKVYFSGKRQACPNWVFQTLVITLIAVMAFCALTIVALYILSLKDQDRRVPN
LPPSNITSSQEPALLPTASSSAPNTSLVTTPASLQVPEITFCEILPCQETYCCPIRGMKE
VSSSPVQRQSEEKEFHQRRWSEDKSKSVLARNALSGPDWESDWIDTTISSIQIMEIQQII
DHQYCIQSLQCGSGNYNYNIPVNKHTPTNVKFSLEINTTEPLIVFQCKFTLGNICFHSKR
GTKGLESHREISQEMTQGYQHIWSLPVAPFSDSMFHFRVAAPDLADCSTDPYFAGIFFTD
YFFYFYRRCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2G1	0.346	0.282	1.342E-83	1151	0.447	0.354	Q9Y2G1.pdb.gz	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
2	AFDB:G5EFI7	0.370	0.363	8.291E-59	931	0.263	0.257	G5EFI7.pdb.gz	MYRF1_CAEEL Myelin regulatory factor homolog 1 OS=Caenorhabditis elegans OX=6239 GN=myrf-1 PE=1 SV=1
3	AFDB:D9PTN5	0.285	0.261	1.156E-58	1009	0.280	0.253	D9PTN5.pdb.gz	MYRF2_CAEEL Myelin regulatory factor homolog 2 OS=Caenorhabditis elegans OX=6239 GN=myrf-2 PE=1 SV=1
4	AFDB:Q54PT9	0.194	0.189	4.083E-32	932	0.146	0.143	Q54PT9.pdb.gz	MRFA_DICDI Myelin gene regulatory factor-like A OS=Dictyostelium discoideum OX=44689 GN=mrfA PE=1 SV=1
5	PDB:3gd1E	0.107	0.275	1.559E-4	300	0.023	0.070	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
6	AFDB:Q99K31	0.070	0.094	1.951E-4	616	0.064	0.094	Q99K31.pdb.gz	Q99K31_MOUSE Col6a3 protein (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
7	PDB:5f0jB	0.095	0.224	4.000E-4	306	0.015	0.046	5f0jB.pdb.gz
8	PDB:5w0pC	0.092	0.097	4.228E-4	850	0.014	0.015	5w0pC.pdb.gz
9	AFDB:O54839	0.093	0.113	6.979E-4	707	0.112	0.144	O54839.pdb.gz	EOMES_MOUSE Eomesodermin homolog OS=Mus musculus OX=10090 GN=Eomes PE=1 SV=3
10	AFDB:P79944	0.087	0.108	9.733E-4	692	0.110	0.145	P79944.pdb.gz	EOMES_XENLA Eomesodermin OS=Xenopus laevis OX=8355 GN=eomes PE=2 SV=1
11	AFDB:Q7YU08	0.062	0.064	1.603E-3	865	0.123	0.129	Q7YU08.pdb.gz	Q7YU08_DROME LD15974p OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=2 SV=1
12	PDB:1ddtA	0.087	0.130	1.888E-3	523	0.030	0.052	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.
13	PDB:2e31A	0.049	0.126	1.888E-3	246	0.020	0.073	2e31A.pdb.gz
14	AFDB:F4I133	0.048	0.046	2.114E-3	963	0.120	0.113	F4I133.pdb.gz	F4I133_ARATH Cysteine proteinases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
15	PDB:3fxiC	0.084	0.349	2.229E-3	140	0.025	0.164	3fxiC.pdb.gz
16	PDB:3gc3A	0.116	0.275	2.229E-3	329	0.014	0.040	3gc3A.pdb.gz
17	PDB:2wtrB	0.097	0.204	2.357E-3	367	0.026	0.065	2wtrB.pdb.gz
18	PDB:2agcA	0.069	0.245	2.633E-3	162	0.012	0.068	2agcA.pdb.gz
19	AFDB:Q4WXZ7	0.041	0.046	3.294E-3	772	0.125	0.148	Q4WXZ7.pdb.gz	Q4WXZ7_ASPFU C2H2 transcription factor (Swi5), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G11250 PE=4 SV=1
20	PDB:7jsmB	0.114	0.240	4.582E-3	383	0.021	0.050	7jsmB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UR85	0.0	560	1138	0.308	0.246	MYRF_MOUSE Myelin regulatory factor OS=Mus musculus OX=10090 GN=Myrf PE=1 SV=2
2	Q9Y2G1	0.0	557	1151	0.308	0.243	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
3	G5EFI7	5.56e-87	300	931	0.255	0.249	MYRF1_CAEEL Myelin regulatory factor homolog 1 OS=Caenorhabditis elegans OX=6239 GN=myrf-1 PE=1 SV=1
4	D9PTN5	1.45e-86	300	1009	0.247	0.223	MYRF2_CAEEL Myelin regulatory factor homolog 2 OS=Caenorhabditis elegans OX=6239 GN=myrf-2 PE=1 SV=1
5	Q54PT9	6.05e-23	107	932	0.057	0.056	MRFA_DICDI Myelin gene regulatory factor-like A OS=Dictyostelium discoideum OX=44689 GN=mrfA PE=1 SV=1
6	E0SDH1	7.3	32.3	342	0.031	0.082	E0SDH1_DICD3 Harpin hrpN OS=Dickeya dadantii (strain 3937) OX=198628 GN=hrpN PE=4 SV=1
7	P34815	7.3	32.7	673	0.033	0.045	UNC18_CAEEL Acetylcholine regulator unc-18 OS=Caenorhabditis elegans OX=6239 GN=unc-18 PE=1 SV=4
8	Q2PZL6	7.4	33.1	4981	0.033	0.006	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
9	P53049	7.9	32.7	1477	0.025	0.016	YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR1 PE=1 SV=1
10	P34420	8.3	32.3	531	0.019	0.032	ESS2_CAEEL Splicing factor ESS-2 OS=Caenorhabditis elegans OX=6239 GN=ess-2 PE=3 SV=2
11	Q9FPE8	9.8	32.0	344	0.022	0.058	HHO3_ARATH Transcription factor HHO3 OS=Arabidopsis thaliana OX=3702 GN=HHO3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20082 DUF6476	45	15.4	Family of unknown function (DUF6476)
2	PF05636 HIGH_NTase1	80	13.9	HIGH Nucleotidyl Transferase
3	PF13888 MRF_C2	1.6e-49	178.9	Myelin gene regulatory factor C-terminal domain 2
4	PF13887 MYRF_ICA	4.1e-18	75.6	Myelin regulatory factor ICA domain
5	PF05224 NDT80_PhoG	2e-24	98.3	NDT80 / PhoG like DNA-binding family
6	PF13884 Peptidase_S74	1.6e-11	55.7	Chaperone of endosialidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000030630

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000003527	0.507	Ankyrin repeat and SOCS box containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.918	organic cyclic compound binding
GO:1901363	0.917	heterocyclic compound binding
GO:0003676	0.870	nucleic acid binding
GO:0042802	0.856	identical protein binding
GO:0003677	0.677	DNA binding
GO:0140110	0.575	transcription regulator activity
GO:0003700	0.460	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.954	cellular process
GO:0050789	0.943	regulation of biological process
GO:0009893	0.928	positive regulation of metabolic process
GO:0032502	0.875	developmental process
GO:0048856	0.849	anatomical structure development
GO:0050794	0.845	regulation of cellular process
GO:0032501	0.818	multicellular organismal process
GO:0031326	0.818	regulation of cellular biosynthetic process
GO:0019219	0.818	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.817	regulation of macromolecule biosynthetic process
GO:0007275	0.666	multicellular organism development
GO:0048522	0.608	positive regulation of cellular process
GO:0010468	0.595	regulation of gene expression
GO:0071704	0.571	organic substance metabolic process
GO:0048731	0.524	system development
GO:0048869	0.478	cellular developmental process
GO:0030154	0.471	cell differentiation
GO:2001141	0.405	regulation of RNA biosynthetic process
GO:0050793	0.371	regulation of developmental process
GO:0010604	0.330	positive regulation of macromolecule metabolic process
GO:0006355	0.309	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005783	0.841	endoplasmic reticulum
GO:0016020	0.839	membrane
GO:0031090	0.556	organelle membrane
GO:0005829	0.545	cytosol
GO:0031974	0.481	membrane-enclosed lumen
GO:0070013	0.474	intracellular organelle lumen
GO:0031981	0.452	nuclear lumen
GO:0005654	0.354	nucleoplasm
GO:0031984	0.305	organelle subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]