StarFunc result for job id Q96LW9

User Input

>input (406 residues)
MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRL
RELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQE
LSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGE
SIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHR
CNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKEC
GKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAF
IQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96LW9	1.000	1.000	1.216E-66	406	1.000	1.000	Q96LW9.pdb.gz	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
2	AFDB:Q8NF99	0.312	0.248	4.027E-37	534	0.537	0.408	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
3	AFDB:O43309	0.349	0.244	1.464E-34	604	0.515	0.346	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
4	AFDB:Q9Y5A6	0.318	0.280	2.161E-34	473	0.490	0.421	Q9Y5A6.pdb.gz	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
5	AFDB:Q86W11	0.366	0.305	3.190E-34	494	0.510	0.419	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
6	AFDB:Q3ZBY5	0.312	0.277	8.212E-34	466	0.493	0.429	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
7	AFDB:Q07231	0.322	0.244	2.792E-33	555	0.483	0.353	Q07231.pdb.gz	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
8	AFDB:Q15776	0.276	0.204	2.952E-33	578	0.515	0.362	Q15776.pdb.gz	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
9	AFDB:Q3MJ62	0.358	0.372	1.186E-32	389	0.507	0.530	Q3MJ62.pdb.gz	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
10	AFDB:Q9BRR0	0.281	0.214	1.566E-32	538	0.493	0.372	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
11	PDB:3w5kB	0.111	0.269	6.056E-5	110	0.103	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.074	0.250	6.553E-1	96	0.034	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:5z56L	0.083	0.077	9.149E-1	342	0.106	0.126	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:6id0L	0.075	0.067	1.596	475	0.103	0.088	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:7dvqM	0.051	0.095	1.993	191	0.086	0.183	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:6gejS	0.072	0.117	2.783	208	0.089	0.173	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:4n78F	0.055	0.126	2.942	156	0.052	0.135	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
18	PDB:2w96A	0.100	0.157	3.288	249	0.039	0.064	2w96A.pdb.gz
19	PDB:6ff4t	0.048	0.097	3.288	172	0.074	0.174	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7vvuP	0.065	0.090	3.675	270	0.042	0.063	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LW9	0.0	830	406	1.000	1.000	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
2	O43309	5.11e-138	409	611	0.549	0.365	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
3	Q8NF99	4.90e-133	394	534	0.542	0.412	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
4	Q3MJ62	3.42e-131	384	389	0.498	0.519	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
5	Q86W11	3.02e-124	370	494	0.537	0.441	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
6	Q15776	1.50e-122	369	578	0.552	0.388	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
7	Q9Y5A6	2.17e-117	352	473	0.483	0.414	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
8	Q9BRR0	4.22e-114	345	538	0.525	0.396	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
9	Q91VN1	3.68e-113	337	368	0.451	0.497	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
10	Q07231	5.22e-113	343	555	0.495	0.362	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
11	Q9H4T2	7.10e-113	336	348	0.448	0.523	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
12	Q3ZBY5	7.90e-113	340	466	0.495	0.431	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
13	O15535	4.57e-112	335	394	0.456	0.470	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
14	P17028	4.74e-111	332	368	0.446	0.492	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
15	P49910	4.83e-110	333	485	0.505	0.423	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
16	Q53Z40	4.83e-110	333	485	0.505	0.423	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
17	Q9UNY5	6.12e-109	328	417	0.490	0.477	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
18	I3L4J6	1.68e-108	328	435	0.473	0.441	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
19	Q16670	8.83e-104	317	478	0.485	0.412	ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2
20	A0A024RCN4	4.75e-103	315	479	0.480	0.407	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	7.4e+02	11.8	TFIIH C1-like domain
2	PF19553 DUF6076	75	14.5	Family of unknown function (DUF6076)
3	PF01363 FYVE	23	16.6	FYVE zinc finger
4	PF02023 SCAN	2.2e-41	150.9	SCAN domain
5	PF01286 XPA_N	0.038	25.3	XPA protein N-terminal
6	PF00096 zf-C2H2	5.2e-29	110.2	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	2.8e-05	35.1	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	1.1e-16	71.1	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	5e-11	53.6	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	0.0017	29.8	Zinc-finger double-stranded RNA-binding
11	PF13465 zf-H2C2_2	7.8e-50	176.4	Zinc-finger double domain
12	PF12874 zf-met	2.8e+02	13.3	Zinc-finger of C2H2 type
13	PF16744 zf-RING_15	30	16.1	KIAA1045 RING finger
14	PF18508 zf_C2H2_13	96	14.0	Zinc finger domain
15	PF18439 zf_UBZ	0.017	26.1	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	36	16.5	zinc-ribbon family
17	PF09723 Zn-ribbon_8	0.0024	29.3	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	45	15.5	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390076

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266014	0.630	Glycosyltransferase 8 domain containing 1
2	9606.ENSP00000345470	0.567	Coiled-coil domain containing 38
3	9606.ENSP00000376417	0.546	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).
4	9606.ENSP00000448182	0.526	TBC1 domain family member 15
5	9606.ENSP00000482968	0.509	Alstrom syndrome protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.985	sequence-specific DNA binding
GO:0003690	0.957	double-stranded DNA binding
GO:1990837	0.954	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051252	0.950	regulation of RNA metabolic process
GO:0009889	0.926	regulation of biosynthetic process
GO:0048518	0.898	positive regulation of biological process
GO:0009987	0.883	cellular process
GO:0048522	0.868	positive regulation of cellular process
GO:0010468	0.842	regulation of gene expression
GO:0009893	0.833	positive regulation of metabolic process
GO:1903506	0.828	regulation of nucleic acid-templated transcription
GO:0006355	0.803	regulation of DNA-templated transcription
GO:0010604	0.782	positive regulation of macromolecule metabolic process
GO:0051173	0.759	positive regulation of nitrogen compound metabolic process
GO:1903508	0.667	positive regulation of nucleic acid-templated transcription
GO:0045893	0.644	positive regulation of DNA-templated transcription
GO:0032501	0.380	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.959	nuclear lumen
GO:0005654	0.901	nucleoplasm
GO:0005737	0.839	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]